SecReT4
Protein ID: 56416861
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM723
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]663149..663547 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PAK0
KEGG IDama:AM723
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.1e-18, Aligned region: 5..102
Protein Sequence: 132 a.a.     [Download]
>gi|56416861|ref|YP_153935.1| hypothetical protein AM723 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLALGILHGVPAAGATGAGTTQAAKDDDTATVVICNVIRFVQKLGLPIMTGVILGSSI
MAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAKGLGGENENFDCAQHTAVNSSPKPAKPLS
 
Nucleotide Sequence: 399 bp     [Download]
>gi|56416370|ref|NC_004842.2|:663149-663547 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CTGCAGGGGCTACTGGTGCAGGGACTACTCAGGCTGCTAAGGATGACGATACAGCGACTGTTGTTATATG
TAACGTTATACGGTTTGTGCAGAAGCTGGGACTACCCATCATGACTGGAGTGATACTAGGTTCTAGCATT
ATGGCTATCTTTGGTAAGCTTGCATGGCCTGCTATTGTAATGTTAGTTGTATTCACAGCTATATTCTTTG
GTGCTGGTAAGCTCATGGCTAAGTTTGCTAAGGGGTTGGGTGGCGAAAATGAGAACTTCGACTGTGCACA
GCATACAGCAGTCAACAGCAGCCCCAAGCCAGCCAAGCCCTTAAGTTAG
 Primer design