SecReT4
Protein ID: 56416918
T4SS name [ID]VirB [496]
Gene symbol-
Locus tagAM810
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]734837..739900 [-]
Producthypothetical protein
Component typeVirB6
UniProt IDQ5PAE3
KEGG IDama:AM810
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.2e-17, Aligned region: 339..539
Protein Sequence: 1687 a.a.     [Download]
>gi|56416918|ref|YP_153992.1| hypothetical protein AM810 [Anaplasma marginale str. St. Maries]
MTLLQEKSKTRNRRSIGLGSMVTIARSAVNKFLRLLPLCLLVASCGSDVPFPRCVSADNFNSNTTASVSA
YYGPGNVEAFKADDGQTGNASTPGANKHMVRWKDTGFVTDGEEIVISIQGAWVPWAKHGEKHSSPLAVNT
GISRPVDLNDEFYDSVVDVGRVCGPYEERKHSVSGCELNCKHIPATDDENTGRYGRPCWLEKGYGAYLLF
KRPEDPDPNSTLDLIEYPVSPTTHLGHAAAGEGKEVSYSSGGKIFGSDCKSIDPQRGWKIYVKILDNYYY
DNAGGYSLEFKKGVINGKGVRIFEYVRKLVRDELDKAGKQIFGNIVENKGFRTFAFAVITLFLVISALVY
LLGMVQAPLADTMVRILKIILVILLVSPGSWDFFHNHLLKLFTGGVDQIIALVNSHAAGQKFKSDAPFDF
MDVMIVDKIFSTVVWEAKARALIMADFASIFALLIIIIAVICYVALCLYGFIIYLTAFVGITFLIALMPI
MFIGILFSRFRSLFDGWLTQCISFSMQAILMFTLIAMFGSLIMHYYYRIFGFTACYNEVLHIKFYALGHR
IIDQKYYEWTPGQKYDPILIGWSGSSRKGEQTDSGTSARYVFTGGGAIIKVPPDYKDRDFRYVDFPFLDP
DAKSSAPPGGVSPIKSQDGEKLESLTSLTNSLIASARGTSTARLVEKIKKELEERVKDKTVTSETKDEFI
KVIEEREKEDAQGKKDVKQKYTDLKFKEKLVTTLTTKLIGTSTVLNPTSAKDLEEQHDYNIIKDLKKGYI
VMWPEVFGLILVAFLVWQMRAFVQHVAVVLAGGSILSRTVASMYSDGFVRIFSHIPVVGTLIDRVDRGID
GLRVLMRAKAGDLASTATRMPENLLKRVPIVGGVLGTAAHGVRSLSSALTASHTEEDLYSMRSISPRFDY
ARAWVGAHLGYSPLDAMKYLGGHALGRITGSETEGLMHNIVQDRAAFLSSLEALTIGVEKYKPSGYAPAQ
KDDDANPFVRPDLKDGTQGADTPSSRLFDSDGKLHVDRENFWDAVDTLHGLGALRARAEDPEVRDRIDED
MNKLRSEITTVAQERPGEVPELAEFVAPSGDVDFARLMEHSLARHDATRADGTHPAEPGHERGAGGEQGA
DDEAARAGVSEMVDDVLQAPDTVDSESGDSMEERSRDTESSALRDAVDEQREVEAGDVDEVQAPPEEEGT
SRTPTDRFEDVLSGSEGAATEDLAGGVVPEGEVGTRTTAPSDVQGEPREAEPDPDYDPAPDYDPDPDYDP
EPDYDPDPDYDEFFDASQDMLADGEEAAAEPAEGLAVEAVSEDEVGTRVTTPSDAQDEPQEVEPRPDYDP
DPDYDPTPDYDPDPDYDHDPDYDPDPDYDGASGVVQGASAGDEEAAVEGIAAGAMSEGEVDEDRGLSLKK
SDRGRSGTSSPEGGRKSSKKGYEEDEHDGGEEQLDYGGAHGDDYEGAKESGLQEVLDKVLSQGIAAESSA
DLADDTAVSDDMAEQAAVLHQDTEAQDPEEAHTHAAQDAGDVEYDVAYSVAEGECAWAEATEMSGYQDDT
TTISDEQPEEAVEGATEVAEDRDAEQQDKGATDSDDADDEFEDAVDVAEAGTEADVTLATLGSHRPEIGG
KVASASQSTGKHTGSGGASRRQQQEERRRQMSALQERIVELQKALDSPNVTETDKQSIEAELSTLKAELD
GLGGSSQ
 
Nucleotide Sequence: 5064 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c739900-734837 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGACACTCCTGCAGGAGAAAAGCAAGACAAGGAATAGGCGGTCTATTGGTCTGGGAAGCATGGTTACTA
TTGCGAGGTCAGCTGTAAACAAATTCCTCAGACTACTGCCGCTGTGCCTGCTTGTTGCATCATGTGGAAG
TGATGTACCGTTTCCCCGTTGTGTGTCCGCGGACAACTTTAACAGCAATACTACTGCTTCTGTATCGGCT
TATTACGGCCCGGGTAACGTGGAGGCGTTCAAAGCTGACGATGGGCAGACAGGTAATGCAAGCACTCCGG
GAGCAAATAAGCACATGGTCCGATGGAAGGACACGGGGTTTGTTACTGATGGGGAAGAGATAGTAATAAG
CATACAGGGAGCATGGGTTCCCTGGGCTAAGCATGGCGAAAAACACAGCTCGCCATTGGCGGTAAATACT
GGCATATCAAGGCCGGTGGACCTAAACGACGAATTTTACGATTCCGTGGTTGATGTAGGTAGGGTGTGCG
GCCCTTACGAAGAACGCAAGCACAGCGTGAGCGGTTGTGAGCTTAACTGTAAACACATACCAGCGACTGA
TGATGAAAATACGGGGCGATACGGGAGGCCATGCTGGCTGGAAAAAGGGTATGGTGCGTATTTGCTGTTC
AAACGTCCGGAGGATCCAGATCCGAACTCCACCCTTGATTTAATAGAATACCCCGTGTCTCCAACCACTC
ACTTGGGGCACGCAGCTGCGGGTGAAGGCAAGGAGGTGTCCTACAGCTCTGGCGGAAAAATATTCGGTAG
TGACTGCAAGTCTATTGATCCGCAAAGAGGGTGGAAAATTTACGTCAAAATATTAGACAATTACTACTAC
GACAACGCCGGTGGTTACAGTTTGGAGTTTAAAAAAGGTGTCATCAACGGCAAAGGTGTCAGGATATTTG
AGTATGTGAGAAAGCTAGTCAGAGATGAACTAGACAAGGCTGGGAAGCAGATATTCGGAAACATTGTAGA
AAACAAGGGGTTCAGGACCTTCGCATTTGCGGTAATAACCTTGTTTTTGGTCATCTCTGCGCTGGTGTAC
CTACTTGGGATGGTGCAAGCACCTCTCGCTGACACAATGGTCCGGATACTGAAGATTATCCTGGTGATAT
TGTTGGTATCTCCCGGTAGTTGGGATTTCTTCCATAATCACCTTCTGAAGCTGTTTACAGGGGGCGTTGA
CCAAATTATAGCACTAGTCAATAGTCACGCCGCTGGGCAGAAATTCAAGTCCGACGCTCCGTTTGACTTT
ATGGACGTGATGATTGTGGACAAAATATTCTCCACCGTTGTGTGGGAAGCCAAGGCCAGAGCCCTCATCA
TGGCGGACTTTGCCTCTATATTTGCGTTGCTGATAATCATAATAGCGGTAATTTGCTACGTAGCCCTGTG
CCTCTACGGCTTTATAATTTACCTTACCGCATTTGTGGGGATCACCTTCCTAATCGCGCTGATGCCTATA
ATGTTTATTGGTATCCTCTTTTCCAGATTCAGAAGCCTTTTTGATGGATGGTTAACGCAGTGCATTAGCT
TCTCGATGCAGGCCATACTGATGTTTACCCTGATCGCGATGTTTGGCTCGCTCATAATGCACTACTACTA
CAGGATTTTCGGCTTTACCGCCTGCTACAACGAGGTGCTGCACATCAAATTTTATGCACTTGGGCACAGA
ATTATCGATCAGAAATACTACGAGTGGACTCCCGGGCAAAAATACGATCCTATACTAATTGGGTGGAGTG
GGTCTTCAAGGAAGGGTGAGCAAACCGACTCTGGAACTTCCGCACGCTATGTGTTTACCGGTGGCGGCGC
TATTATTAAGGTTCCACCAGACTACAAAGATAGGGATTTCCGCTATGTGGACTTCCCGTTCCTAGATCCG
GATGCTAAAAGTTCTGCGCCTCCAGGTGGGGTGTCTCCTATTAAGAGTCAGGATGGCGAAAAGCTGGAAT
CTCTAACTTCCTTGACAAATTCGCTCATCGCCAGTGCACGCGGCACATCAACTGCCAGGTTGGTAGAGAA
GATAAAGAAAGAGCTAGAAGAACGCGTGAAAGATAAAACCGTGACGAGCGAGACGAAGGACGAGTTTATT
AAGGTGATCGAGGAGAGAGAGAAGGAGGACGCACAAGGTAAGAAGGACGTCAAGCAGAAGTACACGGATC
TCAAATTCAAAGAGAAGTTGGTGACAACACTGACCACCAAATTGATAGGTACTAGCACGGTGCTCAATCC
TACGTCTGCTAAGGATCTTGAAGAGCAGCATGATTACAACATAATCAAGGATCTCAAGAAGGGTTACATA
GTTATGTGGCCTGAGGTGTTTGGGCTCATCCTGGTGGCGTTTCTTGTATGGCAGATGAGAGCCTTTGTGC
AGCATGTTGCGGTTGTGCTTGCTGGCGGTAGTATACTGTCAAGGACTGTGGCGTCAATGTACAGTGACGG
GTTTGTCAGGATATTCTCTCATATCCCAGTTGTTGGTACGCTGATAGATCGTGTAGATAGGGGTATAGAT
GGGCTCAGAGTCTTGATGCGGGCAAAGGCGGGGGATTTGGCTTCTACTGCTACCAGGATGCCAGAAAACT
TGCTGAAGAGGGTGCCTATAGTTGGTGGAGTACTTGGCACGGCTGCCCACGGTGTGAGGTCGCTCTCCAG
TGCGCTCACTGCTTCACACACCGAAGAGGATTTGTATTCAATGCGGTCAATTTCGCCCAGATTTGACTAC
GCTAGGGCGTGGGTGGGCGCCCATTTGGGATACTCACCACTAGATGCGATGAAATATCTAGGTGGCCATG
CGCTGGGCCGTATTACGGGTTCCGAGACTGAAGGGTTGATGCACAACATCGTTCAAGATAGGGCAGCATT
TTTGAGCAGTCTGGAAGCGCTTACTATTGGAGTTGAGAAGTACAAGCCCAGTGGGTACGCACCTGCGCAA
AAGGACGATGATGCGAATCCGTTCGTGCGTCCTGACTTGAAAGATGGTACACAGGGCGCTGATACCCCCA
GCAGCAGGCTATTTGATAGCGATGGAAAGTTGCATGTCGATAGGGAAAATTTCTGGGATGCAGTTGATAC
GCTCCATGGCCTTGGTGCGTTACGTGCCCGTGCGGAGGATCCCGAGGTGCGGGATAGAATAGACGAAGAC
ATGAACAAGCTCAGAAGTGAGATCACTACAGTGGCTCAAGAAAGGCCTGGGGAAGTTCCAGAGCTTGCAG
AGTTTGTTGCACCTTCGGGTGACGTCGACTTTGCGCGGCTGATGGAGCATTCCCTTGCTAGGCATGATGC
GACAAGGGCAGACGGAACCCATCCCGCTGAGCCCGGTCATGAACGGGGTGCCGGAGGAGAACAGGGTGCA
GATGATGAGGCTGCAAGGGCAGGTGTTTCCGAAATGGTTGATGATGTTTTACAGGCACCTGATACTGTTG
ATAGTGAATCTGGCGATTCCATGGAGGAACGGAGCCGTGATACCGAGTCTAGTGCTCTGCGTGATGCAGT
GGATGAGCAGCGTGAAGTTGAAGCAGGCGACGTAGACGAGGTGCAGGCCCCACCAGAAGAGGAGGGCACT
TCCAGGACTCCTACGGACCGATTCGAAGATGTGCTTTCGGGTAGCGAAGGAGCCGCTACGGAAGATCTGG
CGGGGGGGGTTGTGCCTGAAGGTGAAGTTGGTACACGGACGACTGCTCCGAGTGATGTGCAAGGTGAGCC
GCGGGAAGCTGAACCTGATCCGGACTATGATCCCGCTCCAGATTATGATCCCGATCCGGACTACGATCCT
GAGCCAGATTATGACCCTGATCCGGACTATGATGAATTTTTCGACGCTTCTCAAGACATGCTTGCGGATG
GCGAGGAAGCAGCTGCAGAACCCGCAGAAGGTTTGGCGGTGGAAGCTGTGTCTGAGGATGAAGTTGGTAC
GCGGGTGACTACTCCGAGTGATGCGCAAGATGAGCCGCAGGAGGTTGAACCTAGGCCAGACTACGATCCT
GATCCAGATTATGATCCCACTCCAGATTATGATCCCGATCCGGACTACGATCATGATCCAGATTATGATC
CCGATCCGGACTATGACGGGGCTTCTGGTGTTGTTCAGGGTGCGTCCGCAGGTGATGAGGAAGCCGCTGT
AGAGGGTATAGCGGCTGGGGCTATGTCTGAGGGTGAAGTTGATGAGGATAGGGGTCTGTCCCTCAAAAAA
TCCGATCGGGGTAGGAGCGGTACTTCAAGCCCAGAGGGTGGCAGAAAATCCAGCAAGAAGGGGTATGAAG
AGGACGAACACGACGGTGGGGAAGAACAGCTCGATTACGGCGGTGCACATGGGGATGACTACGAGGGTGC
TAAGGAGTCTGGCCTGCAAGAAGTGCTTGACAAGGTGCTTTCGCAAGGGATTGCAGCCGAAAGTTCTGCG
GATCTGGCCGATGACACTGCGGTAAGTGATGATATGGCTGAGCAGGCAGCGGTCTTGCACCAAGACACCG
AAGCTCAAGACCCCGAAGAAGCTCATACACATGCCGCCCAGGATGCAGGTGACGTGGAATATGATGTTGC
ATATAGCGTGGCTGAGGGTGAGTGTGCGTGGGCGGAAGCTACGGAAATGTCAGGCTACCAAGATGATACC
ACAACAATCTCTGATGAGCAGCCGGAAGAAGCCGTAGAGGGAGCTACAGAGGTTGCTGAGGACAGAGATG
CAGAACAGCAAGACAAAGGCGCTACTGACAGCGATGATGCGGATGACGAATTTGAAGATGCTGTTGACGT
TGCGGAAGCGGGTACAGAAGCGGATGTAACACTCGCTACGCTTGGCTCGCACCGTCCGGAGATTGGTGGC
AAGGTGGCGAGTGCAAGCCAGTCAACAGGTAAGCATACAGGGTCTGGTGGGGCTTCCAGGAGACAGCAGC
AGGAGGAGCGCAGGAGGCAAATGTCCGCGCTTCAGGAGAGGATTGTGGAGCTGCAAAAAGCTTTAGATTC
GCCCAACGTTACAGAGACCGACAAGCAGAGTATTGAGGCTGAATTGTCGACCTTGAAGGCCGAACTGGAC
GGTCTGGGTGGGTCTTCTCAATAG
 Primer design