SecReT4
Protein ID: 56416918
T4SS name [ID]VirB [496]
Gene symbol-
Locus tagAM810
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]734837..739900 [-]
Producthypothetical protein
Component typeVirB6
UniProt IDQ5PAE3
KEGG IDama:AM810
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.2e-17, Aligned region: 339..539
Protein Sequence: 1687 a.a.     [Download]
>gi|56416918|ref|YP_153992.1| hypothetical protein AM810 [Anaplasma marginale str. St. Maries]
MTLLQEKSKTRNRRSIGLGSMVTIARSAVNKFLRLLPLCLLVASCGSDVPFPRCVSADNFNSNTTASVSA
YYGPGNVEAFKADDGQTGNASTPGANKHMVRWKDTGFVTDGEEIVISIQGAWVPWAKHGEKHSSPLAVNT
GISRPVDLNDEFYDSVVDVGRVCGPYEERKHSVSGCELNCKHIPATDDENTGRYGRPCWLEKGYGAYLLF
KRPEDPDPNSTLDLIEYPVSPTTHLGHAAAGEGKEVSYSSGGKIFGSDCKSIDPQRGWKIYVKILDNYYY
DNAGGYSLEFKKGVINGKGVRIFEYVRKLVRDELDKAGKQIFGNIVENKGFRTFAFAVITLFLVISALVY
LLGMVQAPLADTMVRILKIILVILLVSPGSWDFFHNHLLKLFTGGVDQIIALVNSHAAGQKFKSDAPFDF
MDVMIVDKIFSTVVWEAKARALIMADFASIFALLIIIIAVICYVALCLYGFIIYLTAFVGITFLIALMPI
MFIGILFSRFRSLFDGWLTQCISFSMQAILMFTLIAMFGSLIMHYYYRIFGFTACYNEVLHIKFYALGHR
IIDQKYYEWTPGQKYDPILIGWSGSSRKGEQTDSGTSARYVFTGGGAIIKVPPDYKDRDFRYVDFPFLDP
DAKSSAPPGGVSPIKSQDGEKLESLTSLTNSLIASARGTSTARLVEKIKKELEERVKDKTVTSETKDEFI
KVIEEREKEDAQGKKDVKQKYTDLKFKEKLVTTLTTKLIGTSTVLNPTSAKDLEEQHDYNIIKDLKKGYI
VMWPEVFGLILVAFLVWQMRAFVQHVAVVLAGGSILSRTVASMYSDGFVRIFSHIPVVGTLIDRVDRGID
GLRVLMRAKAGDLASTATRMPENLLKRVPIVGGVLGTAAHGVRSLSSALTASHTEEDLYSMRSISPRFDY
ARAWVGAHLGYSPLDAMKYLGGHALGRITGSETEGLMHNIVQDRAAFLSSLEALTIGVEKYKPSGYAPAQ
KDDDANPFVRPDLKDGTQGADTPSSRLFDSDGKLHVDRENFWDAVDTLHGLGALRARAEDPEVRDRIDED
MNKLRSEITTVAQERPGEVPELAEFVAPSGDVDFARLMEHSLARHDATRADGTHPAEPGHERGAGGEQGA
DDEAARAGVSEMVDDVLQAPDTVDSESGDSMEERSRDTESSALRDAVDEQREVEAGDVDEVQAPPEEEGT
SRTPTDRFEDVLSGSEGAATEDLAGGVVPEGEVGTRTTAPSDVQGEPREAEPDPDYDPAPDYDPDPDYDP
EPDYDPDPDYDEFFDASQDMLADGEEAAAEPAEGLAVEAVSEDEVGTRVTTPSDAQDEPQEVEPRPDYDP
DPDYDPTPDYDPDPDYDHDPDYDPDPDYDGASGVVQGASAGDEEAAVEGIAAGAMSEGEVDEDRGLSLKK
SDRGRSGTSSPEGGRKSSKKGYEEDEHDGGEEQLDYGGAHGDDYEGAKESGLQEVLDKVLSQGIAAESSA
DLADDTAVSDDMAEQAAVLHQDTEAQDPEEAHTHAAQDAGDVEYDVAYSVAEGECAWAEATEMSGYQDDT
TTISDEQPEEAVEGATEVAEDRDAEQQDKGATDSDDADDEFEDAVDVAEAGTEADVTLATLGSHRPEIGG
KVASASQSTGKHTGSGGASRRQQQEERRRQMSALQERIVELQKALDSPNVTETDKQSIEAELSTLKAELD
GLGGSSQ
 
Nucleotide Sequence: 5064 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c739900-734837 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGACACTCCTGCAGGAGAAAAGCAAGACAAGGAATAGGCGGTCTATTGGTCTGGGAAGCATGGTTACTA
TTGCGAGGTCAGCTGTAAACAAATTCCTCAGACTACTGCCGCTGTGCCTGCTTGTTGCATCATGTGGAAG
TGATGTACCGTTTCCCCGTTGTGTGTCCGCGGACAACTTTAACAGCAATACTACTGCTTCTGTATCGGCT
TATTACGGCCCGGGTAACGTGGAGGCGTTCAAAGCTGACGATGGGCAGACAGGTAATGCAAGCACTCCGG
GAGCAAATAAGCACATGGTCCGATGGAAGGACACGGGGTTTGTTACTGATGGGGAAGAGATAGTAATAAG
CATACAGGGAGCATGGGTTCCCTGGGCTAAGCATGGCGAAAAACACAGCTCGCCATTGGCGGTAAATACT
GGCATATCAAGGCCGGTGGACCTAAACGACGAATTTTACGATTCCGTGGTTGATGTAGGTAGGGTGTGCG
GCCCTTACGAAGAACGCAAGCACAGCGTGAGCGGTTGTGAGCTTAACTGTAAACACATACCAGCGACTGA
TGATGAAAATACGGGGCGATACGGGAGGCCATGCTGGCTGGAAAAAGGGTATGGTGCGTATTTGCTGTTC
AAACGTCCGGAGGATCCAGATCCGAACTCCACCCTTGATTTAATAGAATACCCCGTGTCTCCAACCACTC
ACTTGGGGCACGCAGCTGCGGGTGAAGGCAAGGAGGTGTCCTACAGCTCTGGCGGAAAAATATTCGGTAG
TGACTGCAAGTCTATTGATCCGCAAAGAGGGTGGAAAATTTACGTCAAAATATTAGACAATTACTACTAC
GACAACGCCGGTGGTTACAGTTTGGAGTTTAAAAAAGGTGTCATCAACGGCAAAGGTGTCAGGATATTTG
AGTATGTGAGAAAGCTAGTCAGAGATGAACTAGACAAGGCTGGGAAGCAGATATTCGGAAACATTGTAGA
AAACAAGGGGTTCAGGACCTTCGCATTTGCGGTAATAACCTTGTTTTTGGTCATCTCTGCGCTGGTGTAC
CTACTTGGGATGGTGCAAGCACCTCTCGCTGACACAATGGTCCGGATACTGAAGATTATCCTGGTGATAT
TGTTGGTATCTCCCGGTAGTTGGGATTTCTTCCATAATCACCTTCTGAAGCTGTTTACAGGGGGCGTTGA
CCAAATTATAGCACTAGTCAATAGTCACGCCGCTGGGCAGAAATTCAAGTCCGACGCTCCGTTTGACTTT
ATGGACGTGATGATTGTGGACAAAATATTCTCCACCGTTGTGTGGGAAGCCAAGGCCAGAGCCCTCATCA
TGGCGGACTTTGCCTCTATATTTGCGTTGCTGATAATCATAATAGCGGTAATTTGCTACGTAGCCCTGTG
CCTCTACGGCTTTATAATTTACCTTACCGCATTTGTGGGGATCACCTTCCTAATCGCGCTGATGCCTATA
ATGTTTATTGGTATCCTCTTTTCCAGATTCAGAAGCCTTTTTGATGGATGGTTAACGCAGTGCATTAGCT
TCTCGATGCAGGCCATACTGATGTTTACCCTGATCGCGATGTTTGGCTCGCTCATAATGCACTACTACTA
CAGGATTTTCGGCTTTACCGCCTGCTACAACGAGGTGCTGCACATCAAATTTTATGCACTTGGGCACAGA
ATTATCGATCAGAAATACTACGAGTGGACTCCCGGGCAAAAATACGATCCTATACTAATTGGGTGGAGTG
GGTCTTCAAGGAAGGGTGAGCAAACCGACTCTGGAACTTCCGCACGCTATGTGTTTACCGGTGGCGGCGC
TATTATTAAGGTTCCACCAGACTACAAAGATAGGGATTTCCGCTATGTGGACTTCCCGTTCCTAGATCCG
GATGCTAAAAGTTCTGCGCCTCCAGGTGGGGTGTCTCCTATTAAGAGTCAGGATGGCGAAAAGCTGGAAT
CTCTAACTTCCTTGACAAATTCGCTCATCGCCAGTGCACGCGGCACATCAACTGCCAGGTTGGTAGAGAA
GATAAAGAAAGAGCTAGAAGAACGCGTGAAAGATAAAACCGTGACGAGCGAGACGAAGGACGAGTTTATT
AAGGTGATCGAGGAGAGAGAGAAGGAGGACGCACAAGGTAAGAAGGACGTCAAGCAGAAGTACACGGATC
TCAAATTCAAAGAGAAGTTGGTGACAACACTGACCACCAAATTGATAGGTACTAGCACGGTGCTCAATCC
TACGTCTGCTAAGGATCTTGAAGAGCAGCATGATTACAACATAATCAAGGATCTCAAGAAGGGTTACATA
GTTATGTGGCCTGAGGTGTTTGGGCTCATCCTGGTGGCGTTTCTTGTATGGCAGATGAGAGCCTTTGTGC
AGCATGTTGCGGTTGTGCTTGCTGGCGGTAGTATACTGTCAAGGACTGTGGCGTCAATGTACAGTGACGG
GTTTGTCAGGATATTCTCTCATATCCCAGTTGTTGGTACGCTGATAGATCGTGTAGATAGGGGTATAGAT
GGGCTCAGAGTCTTGATGCGGGCAAAGGCGGGGGATTTGGCTTCTACTGCTACCAGGATGCCAGAAAACT
TGCTGAAGAGGGTGCCTATAGTTGGTGGAGTACTTGGCACGGCTGCCCACGGTGTGAGGTCGCTCTCCAG
TGCGCTCACTGCTTCACACACCGAAGAGGATTTGTATTCAATGCGGTCAATTTCGCCCAGATTTGACTAC
GCTAGGGCGTGGGTGGGCGCCCATTTGGGATACTCACCACTAGATGCGATGAAATATCTAGGTGGCCATG
CGCTGGGCCGTATTACGGGTTCCGAGACTGAAGGGTTGATGCACAACATCGTTCAAGATAGGGCAGCATT
TTTGAGCAGTCTGGAAGCGCTTACTATTGGAGTTGAGAAGTACAAGCCCAGTGGGTACGCACCTGCGCAA
AAGGACGATGATGCGAATCCGTTCGTGCGTCCTGACTTGAAAGATGGTACACAGGGCGCTGATACCCCCA
GCAGCAGGCTATTTGATAGCGATGGAAAGTTGCATGTCGATAGGGAAAATTTCTGGGATGCAGTTGATAC
GCTCCATGGCCTTGGTGCGTTACGTGCCCGTGCGGAGGATCCCGAGGTGCGGGATAGAATAGACGAAGAC
ATGAACAAGCTCAGAAGTGAGATCACTACAGTGGCTCAAGAAAGGCCTGGGGAAGTTCCAGAGCTTGCAG
AGTTTGTTGCACCTTCGGGTGACGTCGACTTTGCGCGGCTGATGGAGCATTCCCTTGCTAGGCATGATGC
GACAAGGGCAGACGGAACCCATCCCGCTGAGCCCGGTCATGAACGGGGTGCCGGAGGAGAACAGGGTGCA
GATGATGAGGCTGCAAGGGCAGGTGTTTCCGAAATGGTTGATGATGTTTTACAGGCACCTGATACTGTTG
ATAGTGAATCTGGCGATTCCATGGAGGAACGGAGCCGTGATACCGAGTCTAGTGCTCTGCGTGATGCAGT
GGATGAGCAGCGTGAAGTTGAAGCAGGCGACGTAGACGAGGTGCAGGCCCCACCAGAAGAGGAGGGCACT
TCCAGGACTCCTACGGACCGATTCGAAGATGTGCTTTCGGGTAGCGAAGGAGCCGCTACGGAAGATCTGG
CGGGGGGGGTTGTGCCTGAAGGTGAAGTTGGTACACGGACGACTGCTCCGAGTGATGTGCAAGGTGAGCC
GCGGGAAGCTGAACCTGATCCGGACTATGATCCCGCTCCAGATTATGATCCCGATCCGGACTACGATCCT
GAGCCAGATTATGACCCTGATCCGGACTATGATGAATTTTTCGACGCTTCTCAAGACATGCTTGCGGATG
GCGAGGAAGCAGCTGCAGAACCCGCAGAAGGTTTGGCGGTGGAAGCTGTGTCTGAGGATGAAGTTGGTAC
GCGGGTGACTACTCCGAGTGATGCGCAAGATGAGCCGCAGGAGGTTGAACCTAGGCCAGACTACGATCCT
GATCCAGATTATGATCCCACTCCAGATTATGATCCCGATCCGGACTACGATCATGATCCAGATTATGATC
CCGATCCGGACTATGACGGGGCTTCTGGTGTTGTTCAGGGTGCGTCCGCAGGTGATGAGGAAGCCGCTGT
AGAGGGTATAGCGGCTGGGGCTATGTCTGAGGGTGAAGTTGATGAGGATAGGGGTCTGTCCCTCAAAAAA
TCCGATCGGGGTAGGAGCGGTACTTCAAGCCCAGAGGGTGGCAGAAAATCCAGCAAGAAGGGGTATGAAG
AGGACGAACACGACGGTGGGGAAGAACAGCTCGATTACGGCGGTGCACATGGGGATGACTACGAGGGTGC
TAAGGAGTCTGGCCTGCAAGAAGTGCTTGACAAGGTGCTTTCGCAAGGGATTGCAGCCGAAAGTTCTGCG
GATCTGGCCGATGACACTGCGGTAAGTGATGATATGGCTGAGCAGGCAGCGGTCTTGCACCAAGACACCG
AAGCTCAAGACCCCGAAGAAGCTCATACACATGCCGCCCAGGATGCAGGTGACGTGGAATATGATGTTGC
ATATAGCGTGGCTGAGGGTGAGTGTGCGTGGGCGGAAGCTACGGAAATGTCAGGCTACCAAGATGATACC
ACAACAATCTCTGATGAGCAGCCGGAAGAAGCCGTAGAGGGAGCTACAGAGGTTGCTGAGGACAGAGATG
CAGAACAGCAAGACAAAGGCGCTACTGACAGCGATGATGCGGATGACGAATTTGAAGATGCTGTTGACGT
TGCGGAAGCGGGTACAGAAGCGGATGTAACACTCGCTACGCTTGGCTCGCACCGTCCGGAGATTGGTGGC
AAGGTGGCGAGTGCAAGCCAGTCAACAGGTAAGCATACAGGGTCTGGTGGGGCTTCCAGGAGACAGCAGC
AGGAGGAGCGCAGGAGGCAAATGTCCGCGCTTCAGGAGAGGATTGTGGAGCTGCAAAAAGCTTTAGATTC
GCCCAACGTTACAGAGACCGACAAGCAGAGTATTGAGGCTGAATTGTCGACCTTGAAGGCCGAACTGGAC
GGTCTGGGTGGGTCTTCTCAATAG
 Primer design

Protein ID: 56416919
T4SS name [ID]VirB [496]
Gene symbol-
Locus tagAM811
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]739863..743978 [-]
Producthypothetical protein
Component typeVirB6
UniProt IDQ5PAE2
KEGG IDama:AM811
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.1e-21, Aligned region: 674..867
Protein Sequence: 1371 a.a.     [Download]
>gi|56416919|ref|YP_153993.1| hypothetical protein AM811 [Anaplasma marginale str. St. Maries]
MFRLLLIALVLLISGCGGVCLEPGKGVSSSSVEVKVPVQPPGASRQNPATYWVNSGYLVKEDTELKLTVE
NTISLCPKDASTPATVKMFPEDLTSSRSEHEFYDTLLDVVEGDRVTFFPFLYDLEFPSCERIGNEESFVI
YYGNSDFYKDKECKLGVNSKDICSSGAYGGSASLYYKVLKNGKTECEEVREGIELPKLGGSDVQTPRLAF
PLGYLSKITRDDKQGVLKSNSKYMIATGRIHDGRTVKISGPPEITTALCTELKKDKCITRVMEGRSLADL
KQNQNPGKYEKGVGCNSTQQSGGSQTKPDYDALLRGYTEYDISCNCGLICAPSDQVNKEDCTRSIVRVMN
GKVMCPTTKPKKTIQDNTTIDFEQNPDALKDYLDLPADVNDVKNAAYELAEGAVAVITDKGKDITKDCSG
SSCTFLPEEVKDLSGAGKFSEQSLRMHKSYEVKKSGRLFLSYIKPKNNSGTSGRSDTSNKEEMQGFYTLK
VHRTCYATAGKKLYMYIGENAPTFLPGKNGSNDAVELDLEKDGLNPKGIYYINKKKDGNNGSNGNNGISG
KKGYLYFGIAVDAEYDNQLKDSNHPDNYYSVRLWVPTWEPIISKFFALLQGTLLNILYGTEMSTTQGVAD
VDKVDNIASAVAKSIKENKKGAIQQIYSNQVTSKPFWMLIQGVLTLYLMFSALGYIMGVIKITKYDLAIR
VAKVVFLVCVFSQDSWRFFNEHCFSMFIGGVSDIIEAFNGYLDGDRSFKFLDATLGILLTSELWLRLLAL
IAAGPVGWLAFVGVVWALIEFFLAMFEAMIMYLFSILTVAFLITLAPIFFSFILFQRTRQLFDGWLKMLM
NFSLQPIIIFASLAFLNQMILTSLHAVTDFTACENCAIGLNIPSDDPGTPNRPDICLLPVMLPIGFSNEL
SIDDRHREGLAREDVGFMGLPFGVAIAMILILCCKSIRAFVKISETLAHSISGSVASITASAMGATQGML
GVVGLDAASQQRIAAARGMVPPGEEKLQFENRDGVRPMQEGADPKFSEPDGGGDTAARAAVQGVDGSTVP
DAGPGYDTATGASQDSDSVTGGGAPRVGVPDVTDFGGPGGGELPLMGDQSSDMVQGATSGGDEDVSRSGI
PDDVGVAHYEEVGADAPMGPGGEGAEDDSYGRDMLSGASDDEQSGLHTDSQFDAGPEWGDEPSLFAGEDV
PPAGDTGAANSEELRHGAQDSGAQDSGVHHEDNLDDQSLEQGVGSSDSSDSGADTDEMDRADTTSHAEYS
ESDIGQDDQQQGPEEASADHVQTASSSENTEQRDDYSHQASQGYQAEFVDHLSDDTGEDTDDSTGGRVGI
AGHPVDGAADGYDNGDGKVIEEKLNKNPDNDTPAGEKQDKE
 
Nucleotide Sequence: 4116 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c743978-739863 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTCAGGTTACTGCTCATTGCGTTGGTGTTGCTAATCTCCGGCTGTGGTGGGGTGTGCCTAGAGCCTG
GGAAGGGCGTGAGCAGCAGCTCTGTTGAAGTAAAGGTGCCAGTGCAACCACCTGGTGCTTCCAGGCAGAA
CCCAGCGACCTATTGGGTGAATTCAGGTTACCTTGTTAAGGAGGATACCGAGCTAAAACTTACGGTTGAA
AACACTATCAGCCTTTGTCCCAAGGATGCCAGCACTCCGGCTACGGTAAAAATGTTTCCCGAAGATTTGA
CGTCTTCCCGCTCCGAGCACGAATTTTATGATACCCTGCTCGATGTTGTAGAGGGCGATCGGGTGACCTT
CTTCCCATTTCTTTATGATTTGGAATTTCCATCTTGCGAGAGGATAGGAAACGAAGAAAGCTTTGTAATC
TACTATGGAAATAGTGACTTTTACAAGGACAAGGAGTGTAAGCTGGGTGTTAACTCGAAGGATATATGCT
CTTCCGGCGCCTATGGCGGCTCAGCGTCACTGTACTACAAGGTCCTGAAAAATGGCAAGACAGAATGTGA
GGAGGTGCGTGAAGGTATTGAATTGCCCAAGCTTGGGGGCAGTGATGTGCAAACTCCGCGTCTTGCGTTT
CCTCTGGGCTACCTATCGAAGATTACGAGGGATGACAAACAGGGGGTTTTGAAATCTAACTCAAAGTACA
TGATCGCTACTGGGCGCATTCATGATGGAAGGACAGTTAAGATTAGTGGCCCACCAGAAATAACGACAGC
GCTGTGCACGGAGCTGAAGAAAGACAAGTGCATTACCAGGGTGATGGAGGGGAGGAGCCTTGCTGATCTC
AAGCAGAACCAAAACCCAGGGAAGTATGAGAAGGGTGTAGGTTGCAACAGTACGCAGCAATCTGGTGGTA
GCCAGACCAAACCCGACTATGATGCCCTGCTCAGGGGGTATACGGAGTATGACATAAGCTGTAATTGTGG
TCTGATATGTGCACCCTCAGATCAGGTGAACAAGGAGGACTGCACACGCTCCATTGTGCGGGTTATGAAT
GGTAAAGTCATGTGCCCCACAACGAAGCCTAAGAAAACCATACAAGACAACACGACGATAGATTTTGAGC
AGAATCCCGATGCACTTAAAGATTATTTGGATCTGCCAGCAGATGTAAACGACGTTAAAAACGCCGCTTA
CGAGCTCGCTGAAGGTGCGGTTGCCGTTATTACCGATAAGGGCAAAGACATAACCAAAGACTGTAGCGGT
AGTAGTTGTACATTTCTTCCCGAGGAGGTAAAGGATCTCTCCGGAGCTGGAAAGTTTAGTGAGCAAAGCC
TCAGGATGCACAAGAGTTATGAGGTGAAAAAAAGCGGCAGACTGTTCCTCTCATATATCAAACCTAAAAA
TAATAGTGGCACTTCTGGCCGGAGTGATACAAGTAACAAAGAGGAGATGCAGGGCTTTTATACGCTAAAA
GTCCACAGGACGTGTTACGCGACCGCGGGCAAGAAGCTGTACATGTACATAGGGGAAAACGCACCAACAT
TTTTGCCTGGTAAAAATGGTAGTAACGATGCCGTGGAGCTTGATTTGGAGAAGGATGGTCTGAACCCCAA
GGGTATATACTACATCAACAAGAAGAAAGACGGTAATAATGGCAGTAACGGCAATAATGGTATTAGCGGC
AAGAAAGGATATTTATACTTTGGGATAGCCGTTGATGCAGAATACGACAATCAGCTCAAAGATAGTAACC
ACCCGGATAACTATTATTCAGTACGGCTCTGGGTTCCCACCTGGGAGCCAATAATTTCCAAGTTTTTTGC
GCTCCTGCAAGGCACCCTACTGAACATACTGTATGGCACCGAAATGTCGACTACACAGGGTGTTGCAGAC
GTTGACAAGGTTGACAACATAGCATCCGCGGTTGCGAAATCTATTAAGGAAAACAAGAAGGGGGCCATAC
AGCAAATATACAGCAATCAGGTGACGTCAAAGCCCTTCTGGATGCTCATCCAAGGGGTGCTTACCTTGTA
CCTCATGTTTTCCGCATTGGGGTACATTATGGGTGTGATCAAAATTACCAAGTACGATCTCGCCATAAGA
GTTGCAAAGGTGGTATTCCTGGTGTGCGTGTTCTCACAGGATAGCTGGAGATTTTTCAACGAGCACTGCT
TCAGCATGTTCATTGGAGGAGTGTCAGACATTATTGAGGCGTTCAATGGGTACCTAGATGGCGATAGGTC
GTTCAAGTTTTTAGATGCAACCTTGGGGATACTTCTGACCTCAGAGCTTTGGTTAAGGCTTCTTGCCCTA
ATAGCAGCAGGCCCTGTTGGTTGGCTCGCGTTTGTTGGGGTGGTTTGGGCATTAATAGAGTTCTTCCTGG
CCATGTTTGAAGCCATGATCATGTATTTGTTCTCGATCTTGACCGTGGCATTTCTAATCACCCTGGCCCC
GATATTTTTTTCCTTCATATTGTTTCAGCGCACCCGACAGCTGTTCGATGGGTGGCTTAAGATGCTCATG
AATTTCTCACTCCAGCCGATCATCATATTTGCCTCGCTTGCGTTTTTGAATCAAATGATCCTGACCAGCT
TGCATGCCGTTACCGACTTTACCGCCTGTGAGAACTGCGCTATAGGCCTTAACATACCTTCTGACGACCC
CGGCACTCCTAACAGGCCAGATATATGCCTGCTGCCGGTCATGTTGCCTATAGGCTTTTCCAATGAGCTT
TCTATAGATGATAGGCACCGCGAGGGACTCGCTAGGGAAGACGTAGGATTTATGGGCCTGCCGTTCGGTG
TTGCCATTGCCATGATACTCATACTATGCTGCAAATCTATCAGGGCGTTTGTGAAGATTTCTGAGACTCT
GGCTCACTCAATATCTGGTAGTGTTGCTAGTATAACGGCGAGTGCTATGGGGGCTACCCAGGGCATGCTT
GGGGTCGTAGGCCTAGATGCTGCCTCACAACAGCGGATTGCAGCAGCCAGAGGTATGGTGCCGCCAGGAG
AAGAGAAGCTGCAGTTCGAAAACAGGGATGGCGTGCGACCAATGCAGGAGGGTGCCGATCCGAAATTTTC
AGAGCCCGATGGGGGCGGAGATACTGCGGCCCGTGCGGCAGTACAGGGCGTTGACGGCTCTACTGTCCCG
GATGCCGGACCCGGCTATGATACCGCTACTGGGGCTAGTCAGGATAGCGACAGTGTAACTGGTGGTGGAG
CGCCGAGAGTAGGGGTGCCAGATGTGACTGATTTCGGTGGGCCTGGTGGCGGGGAATTACCACTTATGGG
TGATCAGTCAAGTGATATGGTTCAAGGTGCTACTTCGGGCGGTGATGAAGATGTGAGCAGGTCTGGAATT
CCGGATGATGTCGGTGTAGCGCACTACGAGGAAGTGGGTGCAGATGCGCCTATGGGGCCTGGCGGAGAGG
GGGCCGAGGACGATTCGTACGGGAGAGACATGCTCAGTGGTGCCAGCGATGATGAGCAATCTGGGTTGCA
TACTGATTCACAGTTTGATGCAGGCCCTGAATGGGGGGATGAGCCATCACTTTTTGCGGGCGAAGATGTG
CCGCCAGCTGGTGATACTGGTGCTGCGAACTCAGAAGAGCTCAGACATGGTGCCCAAGATAGTGGTGCCC
AAGATAGTGGTGTACATCACGAAGATAATTTGGATGATCAGTCCCTAGAACAAGGCGTTGGTAGTTCCGA
TTCTAGCGATTCTGGTGCTGATACGGACGAAATGGACCGTGCCGACACCACATCTCACGCTGAATATTCT
GAATCTGATATAGGTCAAGATGATCAACAGCAGGGCCCTGAGGAGGCATCGGCGGATCATGTGCAGACTG
CCAGCAGTTCGGAAAATACTGAACAGAGAGACGATTACAGTCATCAAGCTTCCCAGGGATATCAGGCTGA
GTTTGTTGACCATCTAAGTGATGATACTGGGGAGGATACAGATGACTCTACAGGTGGGCGTGTAGGTATA
GCAGGACACCCTGTAGATGGCGCTGCGGACGGCTACGACAACGGCGATGGGAAGGTCATTGAGGAAAAGT
TAAACAAGAACCCGGATAATGACACTCCTGCAGGAGAAAAGCAAGACAAGGAATAG
 Primer design

Protein ID: 56416920
T4SS name [ID]VirB [496]
Gene symbol-
Locus tagAM812
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]743990..747049 [-]
Producthypothetical protein
Component typeVirB6
UniProt IDQ5PAE1
KEGG IDama:AM812
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.2e-23, Aligned region: 651..867
Protein Sequence: 1019 a.a.     [Download]
>gi|56416920|ref|YP_153994.1| hypothetical protein AM812 [Anaplasma marginale str. St. Maries]
MFCNASALQEHVCLVVKWRACVVLRIIPVVFLMLLSGCGYHGCMSQQDAMNDTVRSVVYTNPKQRSDGTK
GQWVKVDFPVKDKDITLEIEHYNVDFCHDAELSELKLEASPGDDITPGKKKEFTVQFPVKIMPKEKIRFS
LVPIRSFTVDDAICRNLDEDIYAADGEECKKRDIGQQRVINFSHKLVDKHGFMNAWYEVPKNTMASPFVT
GFRPHIIPGKSDEASLKKDFPETNKEDQKYLCYSDYDIGNEAKGTNVSQGSAATAVAAKCEVKCLPFGKY
GYRPGSKEVPTGCYRVCVDYNKQGAANTATAANTNDEELNKVLTKVYQARTRYMRAMDELAANEYCGVLK
TVQSSTTTTENQSGNNSPPKKDYHAYHLLSYDKGNNVLATVLPFVKFGTQTLHPYTFKPADSAQKSNESS
IFASPDSKQKTESGDTITSQIGNLPTKDDAVKAGFKDIESYLELDRDYTVDEPIKIADSEAHTFVLTLEY
PENGNGTDRRNNTDRILVGSYRLKVKKDCGAHLENSLYYTFSESYPEYKPGDSNSKSQPLRFMDKSEIRI
EKTSATGDLYYGVRDNGDGESNNIGHFEIKAIISKTPPKFFSHIVKWTEERVRSALYGNKDKAGGQESVV
ASMYRHISTDGPFNRLVNALLILYVMVSALYFFLGFSRASIFQLFIIFAKVIIVVYVIRPDSWTFFNDHL
FKLFTDGPKSLIAVMTGGVGNTDDFGFMDGILYRFSVSQTWIQLLALIFSGPVGWLTVVLIFWGLFLLVE
CMFSAVVIYLISIMLIALLLCIAPFFLICVLFKRTKAIFDAWIKVLLQTAMQPVLIFSCVAVMVQVVNSV
IYAMLNFQVCEACVLSLDLKIATLCVLRFLLPMGIVPIMPVSDVVRELYNTGETILIGIPGPLFNVLIFV
AVAHATRDFVITSGEMCSIMFGAFTNLSDVGGSAAQALLSVVGMDKMTGHMAEQQKHQSALFYRGAGAGR
EESFASRLMPTSPVAQTGAGAPAKRKPIVVHPADPPASF
 
Nucleotide Sequence: 3060 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c747049-743990 Anaplasma marginale str. St. Maries chromosome, complete genome
TTGTTTTGTAACGCTTCTGCGCTGCAAGAACACGTTTGTCTAGTCGTAAAGTGGAGAGCTTGCGTCGTGC
TGAGGATTATCCCGGTAGTATTTCTTATGCTTCTGTCAGGGTGTGGCTACCACGGCTGTATGTCTCAGCA
AGATGCGATGAATGACACCGTAAGAAGCGTGGTATACACGAACCCAAAGCAACGTAGTGACGGCACGAAG
GGGCAATGGGTGAAGGTGGATTTCCCTGTAAAAGATAAGGACATAACGCTAGAAATAGAACACTACAACG
TGGATTTCTGTCACGACGCGGAGCTGTCAGAGCTGAAGCTGGAGGCGTCTCCGGGAGATGATATCACTCC
GGGGAAGAAGAAAGAATTCACTGTGCAATTTCCAGTGAAGATTATGCCGAAGGAAAAAATACGGTTTTCG
CTCGTTCCCATAAGGAGTTTTACGGTTGACGACGCTATATGCCGGAACCTGGATGAAGACATATATGCTG
CGGATGGAGAGGAGTGTAAAAAGAGAGATATAGGGCAGCAGCGCGTAATAAACTTTAGTCACAAGTTGGT
GGATAAGCACGGCTTTATGAACGCGTGGTACGAAGTGCCAAAAAATACCATGGCATCCCCATTTGTTACG
GGTTTTCGCCCTCATATAATTCCCGGAAAGTCGGATGAAGCATCGCTGAAGAAAGACTTTCCAGAGACAA
ACAAGGAAGACCAGAAGTATTTGTGCTACAGCGATTATGATATAGGGAATGAGGCCAAGGGTACAAACGT
ATCACAAGGATCTGCTGCTACTGCGGTAGCCGCAAAATGTGAGGTTAAATGTTTGCCCTTTGGTAAGTAT
GGCTACCGGCCGGGCAGCAAAGAAGTGCCGACGGGTTGCTATAGAGTGTGCGTGGATTACAATAAGCAAG
GAGCCGCTAACACTGCGACTGCTGCCAACACCAATGACGAAGAATTAAACAAGGTTTTGACCAAGGTGTA
TCAGGCTCGCACCAGATATATGCGCGCAATGGACGAGCTTGCAGCCAACGAATATTGTGGCGTACTTAAG
ACTGTGCAAAGCTCCACAACAACTACAGAAAATCAGAGTGGGAATAACTCACCACCGAAGAAGGACTACC
ATGCTTACCATTTGCTGTCTTATGACAAAGGTAACAACGTACTGGCGACCGTTCTTCCGTTTGTCAAATT
TGGCACACAGACATTGCATCCTTACACATTTAAGCCTGCTGACAGCGCGCAGAAAAGTAATGAAAGCAGC
ATTTTCGCCTCCCCCGATTCAAAACAAAAGACCGAAAGCGGTGATACGATCACATCGCAGATTGGTAATC
TACCAACCAAAGATGATGCGGTCAAAGCGGGGTTTAAAGATATTGAAAGCTATCTAGAACTTGACCGTGA
CTACACAGTTGACGAGCCTATTAAAATTGCTGACAGTGAAGCTCACACGTTTGTACTAACTCTGGAATAC
CCTGAAAACGGAAATGGCACCGACCGCAGGAACAACACCGACAGGATTCTTGTGGGCAGCTATAGACTTA
AGGTCAAGAAAGATTGCGGCGCTCACCTGGAAAATAGCCTGTACTACACGTTTTCCGAGAGTTATCCGGA
ATATAAGCCGGGTGATAGTAACAGCAAATCACAACCGCTGCGATTCATGGATAAAAGCGAAATACGGATT
GAAAAAACTAGCGCAACGGGGGATTTGTATTATGGTGTGCGCGACAACGGTGATGGAGAGTCAAATAATA
TAGGGCACTTCGAGATTAAAGCCATAATTTCCAAAACGCCCCCCAAGTTTTTTTCTCATATTGTGAAGTG
GACAGAAGAAAGAGTGCGTTCCGCGCTGTACGGCAATAAAGACAAAGCTGGTGGGCAGGAAAGCGTTGTA
GCCAGCATGTACAGGCACATTAGCACGGATGGTCCGTTCAACAGGCTTGTGAATGCATTGCTGATTTTAT
ATGTGATGGTCAGCGCACTTTACTTCTTTTTGGGGTTCTCCAGGGCGTCGATCTTCCAGTTGTTTATCAT
CTTTGCAAAAGTCATAATCGTGGTGTACGTAATACGCCCGGACAGCTGGACCTTTTTTAACGATCATCTG
TTCAAATTGTTTACAGATGGCCCCAAAAGTTTGATTGCCGTCATGACTGGTGGTGTTGGAAACACCGATG
ATTTTGGATTTATGGATGGCATACTATATAGGTTTTCGGTCTCGCAAACGTGGATTCAGCTGCTAGCACT
CATATTTTCTGGCCCTGTGGGGTGGCTCACAGTGGTGCTAATTTTCTGGGGGCTGTTCCTCCTGGTGGAA
TGCATGTTCAGTGCGGTGGTGATATACCTAATATCCATTATGCTGATAGCGCTGTTGTTGTGTATAGCGC
CGTTCTTTTTGATATGCGTGCTGTTTAAACGTACCAAGGCGATATTTGATGCTTGGATAAAGGTATTGTT
ACAAACTGCGATGCAGCCGGTTTTGATCTTCTCTTGCGTTGCCGTGATGGTGCAAGTAGTCAACAGTGTA
ATATATGCGATGCTCAACTTCCAAGTGTGCGAAGCTTGCGTTTTGTCGCTAGACTTGAAAATCGCCACTT
TGTGCGTGCTACGCTTTCTTCTACCAATGGGAATAGTCCCGATCATGCCGGTTAGCGATGTTGTAAGGGA
GTTATACAATACTGGAGAAACGATCCTCATAGGAATACCTGGCCCGCTATTTAACGTGCTAATTTTTGTG
GCCGTGGCCCACGCTACTAGGGACTTTGTGATCACCAGTGGTGAGATGTGTAGTATCATGTTCGGTGCGT
TTACCAACCTGTCCGATGTGGGTGGAAGCGCAGCGCAGGCTCTGTTGAGCGTAGTTGGAATGGATAAAAT
GACTGGACATATGGCGGAACAGCAGAAACATCAGTCCGCGCTCTTCTACAGAGGGGCAGGTGCCGGACGC
GAGGAGAGCTTTGCTTCCAGACTCATGCCTACTTCCCCAGTGGCACAGACTGGTGCCGGTGCACCTGCCA
AGCGCAAGCCTATTGTTGTCCATCCTGCTGATCCTCCGGCTAGCTTTTAG
 Primer design

Protein ID: 56416921
T4SS name [ID]VirB [496]
Gene symbolvirB6
Locus tagAM813
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]747102..749738 [-]
ProductVirB6 protein
Component typeVirB6
UniProt IDQ5PAE0
KEGG IDama:AM813
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.2e-12, Aligned region: 476..706
Protein Sequence: 878 a.a.     [Download]
>gi|56416921|ref|YP_153995.1| VirB6 protein [Anaplasma marginale str. St. Maries]
MRRAVRAIALMVLFVWLPFVPHYAAYSDEPKKEEESDRLVSYRYAEATNPRCGAAATVAEVGAKVIGPSL
GLMITGAVLVKIPLGWTTKAGFALIASNVAIISAAVAASSAYFVCNWSFVRHPVLRFEEGETVTGQSGTP
TVLTEHTSNTGDTSSFKIGNYKECENPHAPDADVKAKWESSGTSGGTDGCSKEFADLNSYFACIAPQKSL
EVAKTLEPVCKDRKFKQVNHYAWPKNRVSSSRYIEVCYRKPLATLFAGAYRALKNQTKSESYTEQIKKGA
YPREGTYGDESMHKTKLAISGAGGDNIGAHVECKVLWAGKEETIHDAQFRAVERGDKLCVDAVSVSKLPL
IPRPEIGCQMRPNSPPVPMCEKSKAVMGEAGTERAGKVVKYDNEKCYSCYVDQACQGTASVHTKSPFPVT
SVLVNCIVGSLKNVLDPTSGGGQKCAHKSTTPGGPNPGFLKVAQKKLKNAVMAALILALILFSIKAMLGG
VQNASELYMTAIKFALVVYFTQGDAMSKSYDYLTKLSIGLSDIVLAAANGGQDICNYKTETYDENFRYLV
PWDRLDCRMMFYLGSQLNGGTGTGVLLTVFLCAGLLIPAILINAKVIICVVAFFAVMMLIFTVIWCVYVF
LLSLIALTVLTIISPLMIPMCLFQVTKGFFDGWTRQLMVYSLYPVILFSFLSLMFTVFDNIYFGELKFQQ
DDITIGSSKRVNFKLTNPKACDDPKMDSNLACMFSTVNFHTKPLVLGLSVTSPEFKETTAAIWTKLGVFV
LVGFLFYHFLSSISYIAGELAGDPRAGVIGSGSFNPRALAGGAMGVASKISNYASGKMSDAGSKMMDRMK
GGGQAGGGGSDKVSGGSSPRSSNAGAGMDSVSGGSSGT
 
Nucleotide Sequence: 2637 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c749738-747102 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGCGTAGAGCGGTCAGGGCAATAGCACTGATGGTCCTATTTGTGTGGCTGCCATTTGTGCCGCATTATG
CCGCATATTCTGATGAGCCTAAGAAGGAGGAAGAGAGTGACCGCTTGGTGAGCTACAGATACGCCGAGGC
CACTAACCCCCGTTGTGGTGCTGCGGCCACGGTAGCTGAAGTAGGTGCTAAAGTTATAGGTCCGTCGCTG
GGGCTTATGATAACCGGCGCAGTATTAGTAAAGATACCCCTTGGTTGGACCACCAAGGCCGGGTTCGCGC
TAATTGCCTCAAATGTGGCGATTATATCCGCAGCTGTTGCCGCGTCCTCGGCATATTTTGTCTGTAATTG
GAGCTTCGTACGCCACCCTGTTTTGCGCTTCGAGGAAGGAGAAACAGTAACGGGTCAAAGCGGCACCCCA
ACGGTGCTGACGGAACACACCTCTAATACTGGTGACACGAGCAGTTTCAAAATTGGAAATTACAAGGAGT
GCGAGAATCCGCATGCGCCAGATGCGGATGTGAAAGCAAAGTGGGAAAGCAGCGGCACGTCAGGTGGCAC
AGATGGATGCTCCAAGGAATTTGCCGATTTGAACAGTTATTTCGCGTGCATTGCACCGCAGAAGAGCTTG
GAAGTAGCCAAAACGCTGGAGCCCGTGTGTAAGGATAGGAAGTTCAAGCAAGTTAATCACTATGCGTGGC
CAAAGAATCGGGTCTCCAGCTCCCGCTACATCGAAGTCTGCTATCGCAAACCGCTTGCAACACTATTTGC
AGGTGCGTACAGGGCGCTGAAAAATCAAACGAAAAGCGAGAGCTATACTGAACAAATAAAAAAGGGAGCC
TATCCGCGTGAGGGCACATACGGTGACGAGAGCATGCATAAAACCAAGCTCGCCATTTCTGGGGCTGGAG
GTGACAACATTGGCGCACACGTAGAATGTAAGGTGCTTTGGGCTGGAAAAGAGGAGACTATACATGATGC
CCAATTTCGCGCTGTTGAGCGGGGCGATAAGCTCTGCGTGGATGCGGTGAGCGTAAGTAAGTTACCACTT
ATTCCCAGGCCGGAGATAGGCTGTCAGATGCGTCCTAATTCGCCCCCGGTTCCTATGTGCGAGAAGTCAA
AGGCAGTAATGGGTGAAGCAGGCACAGAAAGGGCTGGTAAAGTTGTCAAATACGACAATGAAAAATGCTA
CAGTTGTTACGTGGACCAGGCATGCCAAGGCACTGCTTCAGTGCACACGAAGTCTCCGTTTCCTGTTACC
TCTGTGCTTGTAAACTGCATAGTTGGATCTTTGAAGAATGTGCTGGACCCCACTAGTGGTGGTGGCCAAA
AGTGTGCGCACAAATCCACTACTCCGGGGGGCCCAAACCCTGGATTCTTGAAGGTGGCACAGAAGAAGCT
CAAGAACGCTGTTATGGCTGCGTTGATACTTGCACTGATTTTGTTCTCGATCAAAGCTATGCTCGGTGGG
GTGCAGAACGCATCTGAACTGTATATGACGGCGATAAAATTTGCCTTGGTTGTCTACTTTACCCAGGGTG
ATGCGATGAGCAAGTCATATGACTACCTGACAAAACTTTCGATTGGTCTCTCAGACATTGTGCTGGCTGC
CGCCAATGGGGGGCAAGACATTTGCAACTACAAGACAGAGACTTACGATGAGAATTTCCGATACCTGGTG
CCATGGGATAGGTTGGACTGCAGGATGATGTTTTACCTTGGTAGCCAGCTCAATGGGGGGACAGGGACCG
GCGTTTTACTGACTGTGTTCCTTTGTGCCGGTCTGTTGATACCCGCAATCCTCATAAACGCCAAGGTGAT
AATATGTGTTGTAGCGTTCTTTGCGGTGATGATGCTGATATTTACCGTGATATGGTGTGTGTATGTGTTC
CTACTGTCATTAATCGCCCTTACGGTTCTTACAATCATATCCCCCCTCATGATACCCATGTGCCTTTTCC
AGGTTACCAAGGGATTCTTTGATGGGTGGACCAGACAGCTTATGGTGTACTCTTTGTATCCGGTAATATT
GTTTTCGTTCCTGTCGCTGATGTTTACTGTTTTTGACAACATATACTTTGGGGAGTTGAAGTTTCAGCAA
GACGACATAACGATAGGCAGCAGTAAGAGGGTGAACTTTAAGCTTACAAACCCTAAAGCCTGCGATGACC
CGAAGATGGACAGCAATCTGGCATGCATGTTTAGCACAGTAAACTTCCATACAAAACCGCTGGTGCTTGG
GCTGTCAGTTACAAGTCCAGAGTTTAAGGAGACAACTGCTGCAATTTGGACCAAGCTTGGGGTGTTTGTA
CTTGTAGGGTTCTTATTCTATCACTTCTTGTCTTCCATATCTTACATCGCCGGGGAACTTGCGGGAGATC
CGAGGGCTGGTGTTATCGGTTCGGGTAGCTTCAATCCTAGAGCGCTTGCCGGTGGGGCTATGGGTGTCGC
TTCCAAGATCAGCAACTATGCTTCGGGCAAGATGTCTGATGCAGGAAGCAAGATGATGGATCGCATGAAG
GGAGGAGGCCAGGCAGGGGGTGGTGGATCCGATAAGGTCTCGGGTGGCAGCTCCCCTAGGAGTAGTAATG
CAGGTGCCGGTATGGATTCTGTGTCTGGAGGGTCGTCTGGGACGTAA
 Primer design