SecReT4
Protein ID: 56416919
T4SS name [ID]VirB [496]
Gene symbol-
Locus tagAM811
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]739863..743978 [-]
Producthypothetical protein
Component typeVirB6
UniProt IDQ5PAE2
KEGG IDama:AM811
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.1e-21, Aligned region: 674..867
Protein Sequence: 1371 a.a.     [Download]
>gi|56416919|ref|YP_153993.1| hypothetical protein AM811 [Anaplasma marginale str. St. Maries]
MFRLLLIALVLLISGCGGVCLEPGKGVSSSSVEVKVPVQPPGASRQNPATYWVNSGYLVKEDTELKLTVE
NTISLCPKDASTPATVKMFPEDLTSSRSEHEFYDTLLDVVEGDRVTFFPFLYDLEFPSCERIGNEESFVI
YYGNSDFYKDKECKLGVNSKDICSSGAYGGSASLYYKVLKNGKTECEEVREGIELPKLGGSDVQTPRLAF
PLGYLSKITRDDKQGVLKSNSKYMIATGRIHDGRTVKISGPPEITTALCTELKKDKCITRVMEGRSLADL
KQNQNPGKYEKGVGCNSTQQSGGSQTKPDYDALLRGYTEYDISCNCGLICAPSDQVNKEDCTRSIVRVMN
GKVMCPTTKPKKTIQDNTTIDFEQNPDALKDYLDLPADVNDVKNAAYELAEGAVAVITDKGKDITKDCSG
SSCTFLPEEVKDLSGAGKFSEQSLRMHKSYEVKKSGRLFLSYIKPKNNSGTSGRSDTSNKEEMQGFYTLK
VHRTCYATAGKKLYMYIGENAPTFLPGKNGSNDAVELDLEKDGLNPKGIYYINKKKDGNNGSNGNNGISG
KKGYLYFGIAVDAEYDNQLKDSNHPDNYYSVRLWVPTWEPIISKFFALLQGTLLNILYGTEMSTTQGVAD
VDKVDNIASAVAKSIKENKKGAIQQIYSNQVTSKPFWMLIQGVLTLYLMFSALGYIMGVIKITKYDLAIR
VAKVVFLVCVFSQDSWRFFNEHCFSMFIGGVSDIIEAFNGYLDGDRSFKFLDATLGILLTSELWLRLLAL
IAAGPVGWLAFVGVVWALIEFFLAMFEAMIMYLFSILTVAFLITLAPIFFSFILFQRTRQLFDGWLKMLM
NFSLQPIIIFASLAFLNQMILTSLHAVTDFTACENCAIGLNIPSDDPGTPNRPDICLLPVMLPIGFSNEL
SIDDRHREGLAREDVGFMGLPFGVAIAMILILCCKSIRAFVKISETLAHSISGSVASITASAMGATQGML
GVVGLDAASQQRIAAARGMVPPGEEKLQFENRDGVRPMQEGADPKFSEPDGGGDTAARAAVQGVDGSTVP
DAGPGYDTATGASQDSDSVTGGGAPRVGVPDVTDFGGPGGGELPLMGDQSSDMVQGATSGGDEDVSRSGI
PDDVGVAHYEEVGADAPMGPGGEGAEDDSYGRDMLSGASDDEQSGLHTDSQFDAGPEWGDEPSLFAGEDV
PPAGDTGAANSEELRHGAQDSGAQDSGVHHEDNLDDQSLEQGVGSSDSSDSGADTDEMDRADTTSHAEYS
ESDIGQDDQQQGPEEASADHVQTASSSENTEQRDDYSHQASQGYQAEFVDHLSDDTGEDTDDSTGGRVGI
AGHPVDGAADGYDNGDGKVIEEKLNKNPDNDTPAGEKQDKE
 
Nucleotide Sequence: 4116 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c743978-739863 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTCAGGTTACTGCTCATTGCGTTGGTGTTGCTAATCTCCGGCTGTGGTGGGGTGTGCCTAGAGCCTG
GGAAGGGCGTGAGCAGCAGCTCTGTTGAAGTAAAGGTGCCAGTGCAACCACCTGGTGCTTCCAGGCAGAA
CCCAGCGACCTATTGGGTGAATTCAGGTTACCTTGTTAAGGAGGATACCGAGCTAAAACTTACGGTTGAA
AACACTATCAGCCTTTGTCCCAAGGATGCCAGCACTCCGGCTACGGTAAAAATGTTTCCCGAAGATTTGA
CGTCTTCCCGCTCCGAGCACGAATTTTATGATACCCTGCTCGATGTTGTAGAGGGCGATCGGGTGACCTT
CTTCCCATTTCTTTATGATTTGGAATTTCCATCTTGCGAGAGGATAGGAAACGAAGAAAGCTTTGTAATC
TACTATGGAAATAGTGACTTTTACAAGGACAAGGAGTGTAAGCTGGGTGTTAACTCGAAGGATATATGCT
CTTCCGGCGCCTATGGCGGCTCAGCGTCACTGTACTACAAGGTCCTGAAAAATGGCAAGACAGAATGTGA
GGAGGTGCGTGAAGGTATTGAATTGCCCAAGCTTGGGGGCAGTGATGTGCAAACTCCGCGTCTTGCGTTT
CCTCTGGGCTACCTATCGAAGATTACGAGGGATGACAAACAGGGGGTTTTGAAATCTAACTCAAAGTACA
TGATCGCTACTGGGCGCATTCATGATGGAAGGACAGTTAAGATTAGTGGCCCACCAGAAATAACGACAGC
GCTGTGCACGGAGCTGAAGAAAGACAAGTGCATTACCAGGGTGATGGAGGGGAGGAGCCTTGCTGATCTC
AAGCAGAACCAAAACCCAGGGAAGTATGAGAAGGGTGTAGGTTGCAACAGTACGCAGCAATCTGGTGGTA
GCCAGACCAAACCCGACTATGATGCCCTGCTCAGGGGGTATACGGAGTATGACATAAGCTGTAATTGTGG
TCTGATATGTGCACCCTCAGATCAGGTGAACAAGGAGGACTGCACACGCTCCATTGTGCGGGTTATGAAT
GGTAAAGTCATGTGCCCCACAACGAAGCCTAAGAAAACCATACAAGACAACACGACGATAGATTTTGAGC
AGAATCCCGATGCACTTAAAGATTATTTGGATCTGCCAGCAGATGTAAACGACGTTAAAAACGCCGCTTA
CGAGCTCGCTGAAGGTGCGGTTGCCGTTATTACCGATAAGGGCAAAGACATAACCAAAGACTGTAGCGGT
AGTAGTTGTACATTTCTTCCCGAGGAGGTAAAGGATCTCTCCGGAGCTGGAAAGTTTAGTGAGCAAAGCC
TCAGGATGCACAAGAGTTATGAGGTGAAAAAAAGCGGCAGACTGTTCCTCTCATATATCAAACCTAAAAA
TAATAGTGGCACTTCTGGCCGGAGTGATACAAGTAACAAAGAGGAGATGCAGGGCTTTTATACGCTAAAA
GTCCACAGGACGTGTTACGCGACCGCGGGCAAGAAGCTGTACATGTACATAGGGGAAAACGCACCAACAT
TTTTGCCTGGTAAAAATGGTAGTAACGATGCCGTGGAGCTTGATTTGGAGAAGGATGGTCTGAACCCCAA
GGGTATATACTACATCAACAAGAAGAAAGACGGTAATAATGGCAGTAACGGCAATAATGGTATTAGCGGC
AAGAAAGGATATTTATACTTTGGGATAGCCGTTGATGCAGAATACGACAATCAGCTCAAAGATAGTAACC
ACCCGGATAACTATTATTCAGTACGGCTCTGGGTTCCCACCTGGGAGCCAATAATTTCCAAGTTTTTTGC
GCTCCTGCAAGGCACCCTACTGAACATACTGTATGGCACCGAAATGTCGACTACACAGGGTGTTGCAGAC
GTTGACAAGGTTGACAACATAGCATCCGCGGTTGCGAAATCTATTAAGGAAAACAAGAAGGGGGCCATAC
AGCAAATATACAGCAATCAGGTGACGTCAAAGCCCTTCTGGATGCTCATCCAAGGGGTGCTTACCTTGTA
CCTCATGTTTTCCGCATTGGGGTACATTATGGGTGTGATCAAAATTACCAAGTACGATCTCGCCATAAGA
GTTGCAAAGGTGGTATTCCTGGTGTGCGTGTTCTCACAGGATAGCTGGAGATTTTTCAACGAGCACTGCT
TCAGCATGTTCATTGGAGGAGTGTCAGACATTATTGAGGCGTTCAATGGGTACCTAGATGGCGATAGGTC
GTTCAAGTTTTTAGATGCAACCTTGGGGATACTTCTGACCTCAGAGCTTTGGTTAAGGCTTCTTGCCCTA
ATAGCAGCAGGCCCTGTTGGTTGGCTCGCGTTTGTTGGGGTGGTTTGGGCATTAATAGAGTTCTTCCTGG
CCATGTTTGAAGCCATGATCATGTATTTGTTCTCGATCTTGACCGTGGCATTTCTAATCACCCTGGCCCC
GATATTTTTTTCCTTCATATTGTTTCAGCGCACCCGACAGCTGTTCGATGGGTGGCTTAAGATGCTCATG
AATTTCTCACTCCAGCCGATCATCATATTTGCCTCGCTTGCGTTTTTGAATCAAATGATCCTGACCAGCT
TGCATGCCGTTACCGACTTTACCGCCTGTGAGAACTGCGCTATAGGCCTTAACATACCTTCTGACGACCC
CGGCACTCCTAACAGGCCAGATATATGCCTGCTGCCGGTCATGTTGCCTATAGGCTTTTCCAATGAGCTT
TCTATAGATGATAGGCACCGCGAGGGACTCGCTAGGGAAGACGTAGGATTTATGGGCCTGCCGTTCGGTG
TTGCCATTGCCATGATACTCATACTATGCTGCAAATCTATCAGGGCGTTTGTGAAGATTTCTGAGACTCT
GGCTCACTCAATATCTGGTAGTGTTGCTAGTATAACGGCGAGTGCTATGGGGGCTACCCAGGGCATGCTT
GGGGTCGTAGGCCTAGATGCTGCCTCACAACAGCGGATTGCAGCAGCCAGAGGTATGGTGCCGCCAGGAG
AAGAGAAGCTGCAGTTCGAAAACAGGGATGGCGTGCGACCAATGCAGGAGGGTGCCGATCCGAAATTTTC
AGAGCCCGATGGGGGCGGAGATACTGCGGCCCGTGCGGCAGTACAGGGCGTTGACGGCTCTACTGTCCCG
GATGCCGGACCCGGCTATGATACCGCTACTGGGGCTAGTCAGGATAGCGACAGTGTAACTGGTGGTGGAG
CGCCGAGAGTAGGGGTGCCAGATGTGACTGATTTCGGTGGGCCTGGTGGCGGGGAATTACCACTTATGGG
TGATCAGTCAAGTGATATGGTTCAAGGTGCTACTTCGGGCGGTGATGAAGATGTGAGCAGGTCTGGAATT
CCGGATGATGTCGGTGTAGCGCACTACGAGGAAGTGGGTGCAGATGCGCCTATGGGGCCTGGCGGAGAGG
GGGCCGAGGACGATTCGTACGGGAGAGACATGCTCAGTGGTGCCAGCGATGATGAGCAATCTGGGTTGCA
TACTGATTCACAGTTTGATGCAGGCCCTGAATGGGGGGATGAGCCATCACTTTTTGCGGGCGAAGATGTG
CCGCCAGCTGGTGATACTGGTGCTGCGAACTCAGAAGAGCTCAGACATGGTGCCCAAGATAGTGGTGCCC
AAGATAGTGGTGTACATCACGAAGATAATTTGGATGATCAGTCCCTAGAACAAGGCGTTGGTAGTTCCGA
TTCTAGCGATTCTGGTGCTGATACGGACGAAATGGACCGTGCCGACACCACATCTCACGCTGAATATTCT
GAATCTGATATAGGTCAAGATGATCAACAGCAGGGCCCTGAGGAGGCATCGGCGGATCATGTGCAGACTG
CCAGCAGTTCGGAAAATACTGAACAGAGAGACGATTACAGTCATCAAGCTTCCCAGGGATATCAGGCTGA
GTTTGTTGACCATCTAAGTGATGATACTGGGGAGGATACAGATGACTCTACAGGTGGGCGTGTAGGTATA
GCAGGACACCCTGTAGATGGCGCTGCGGACGGCTACGACAACGGCGATGGGAAGGTCATTGAGGAAAAGT
TAAACAAGAACCCGGATAATGACACTCCTGCAGGAGAAAAGCAAGACAAGGAATAG
 Primer design