SecReT4
Protein ID: 56416920
T4SS name [ID]VirB [496]
Gene symbol-
Locus tagAM812
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]743990..747049 [-]
Producthypothetical protein
Component typeVirB6
UniProt IDQ5PAE1
KEGG IDama:AM812
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.2e-23, Aligned region: 651..867
Protein Sequence: 1019 a.a.     [Download]
>gi|56416920|ref|YP_153994.1| hypothetical protein AM812 [Anaplasma marginale str. St. Maries]
MFCNASALQEHVCLVVKWRACVVLRIIPVVFLMLLSGCGYHGCMSQQDAMNDTVRSVVYTNPKQRSDGTK
GQWVKVDFPVKDKDITLEIEHYNVDFCHDAELSELKLEASPGDDITPGKKKEFTVQFPVKIMPKEKIRFS
LVPIRSFTVDDAICRNLDEDIYAADGEECKKRDIGQQRVINFSHKLVDKHGFMNAWYEVPKNTMASPFVT
GFRPHIIPGKSDEASLKKDFPETNKEDQKYLCYSDYDIGNEAKGTNVSQGSAATAVAAKCEVKCLPFGKY
GYRPGSKEVPTGCYRVCVDYNKQGAANTATAANTNDEELNKVLTKVYQARTRYMRAMDELAANEYCGVLK
TVQSSTTTTENQSGNNSPPKKDYHAYHLLSYDKGNNVLATVLPFVKFGTQTLHPYTFKPADSAQKSNESS
IFASPDSKQKTESGDTITSQIGNLPTKDDAVKAGFKDIESYLELDRDYTVDEPIKIADSEAHTFVLTLEY
PENGNGTDRRNNTDRILVGSYRLKVKKDCGAHLENSLYYTFSESYPEYKPGDSNSKSQPLRFMDKSEIRI
EKTSATGDLYYGVRDNGDGESNNIGHFEIKAIISKTPPKFFSHIVKWTEERVRSALYGNKDKAGGQESVV
ASMYRHISTDGPFNRLVNALLILYVMVSALYFFLGFSRASIFQLFIIFAKVIIVVYVIRPDSWTFFNDHL
FKLFTDGPKSLIAVMTGGVGNTDDFGFMDGILYRFSVSQTWIQLLALIFSGPVGWLTVVLIFWGLFLLVE
CMFSAVVIYLISIMLIALLLCIAPFFLICVLFKRTKAIFDAWIKVLLQTAMQPVLIFSCVAVMVQVVNSV
IYAMLNFQVCEACVLSLDLKIATLCVLRFLLPMGIVPIMPVSDVVRELYNTGETILIGIPGPLFNVLIFV
AVAHATRDFVITSGEMCSIMFGAFTNLSDVGGSAAQALLSVVGMDKMTGHMAEQQKHQSALFYRGAGAGR
EESFASRLMPTSPVAQTGAGAPAKRKPIVVHPADPPASF
 
Nucleotide Sequence: 3060 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c747049-743990 Anaplasma marginale str. St. Maries chromosome, complete genome
TTGTTTTGTAACGCTTCTGCGCTGCAAGAACACGTTTGTCTAGTCGTAAAGTGGAGAGCTTGCGTCGTGC
TGAGGATTATCCCGGTAGTATTTCTTATGCTTCTGTCAGGGTGTGGCTACCACGGCTGTATGTCTCAGCA
AGATGCGATGAATGACACCGTAAGAAGCGTGGTATACACGAACCCAAAGCAACGTAGTGACGGCACGAAG
GGGCAATGGGTGAAGGTGGATTTCCCTGTAAAAGATAAGGACATAACGCTAGAAATAGAACACTACAACG
TGGATTTCTGTCACGACGCGGAGCTGTCAGAGCTGAAGCTGGAGGCGTCTCCGGGAGATGATATCACTCC
GGGGAAGAAGAAAGAATTCACTGTGCAATTTCCAGTGAAGATTATGCCGAAGGAAAAAATACGGTTTTCG
CTCGTTCCCATAAGGAGTTTTACGGTTGACGACGCTATATGCCGGAACCTGGATGAAGACATATATGCTG
CGGATGGAGAGGAGTGTAAAAAGAGAGATATAGGGCAGCAGCGCGTAATAAACTTTAGTCACAAGTTGGT
GGATAAGCACGGCTTTATGAACGCGTGGTACGAAGTGCCAAAAAATACCATGGCATCCCCATTTGTTACG
GGTTTTCGCCCTCATATAATTCCCGGAAAGTCGGATGAAGCATCGCTGAAGAAAGACTTTCCAGAGACAA
ACAAGGAAGACCAGAAGTATTTGTGCTACAGCGATTATGATATAGGGAATGAGGCCAAGGGTACAAACGT
ATCACAAGGATCTGCTGCTACTGCGGTAGCCGCAAAATGTGAGGTTAAATGTTTGCCCTTTGGTAAGTAT
GGCTACCGGCCGGGCAGCAAAGAAGTGCCGACGGGTTGCTATAGAGTGTGCGTGGATTACAATAAGCAAG
GAGCCGCTAACACTGCGACTGCTGCCAACACCAATGACGAAGAATTAAACAAGGTTTTGACCAAGGTGTA
TCAGGCTCGCACCAGATATATGCGCGCAATGGACGAGCTTGCAGCCAACGAATATTGTGGCGTACTTAAG
ACTGTGCAAAGCTCCACAACAACTACAGAAAATCAGAGTGGGAATAACTCACCACCGAAGAAGGACTACC
ATGCTTACCATTTGCTGTCTTATGACAAAGGTAACAACGTACTGGCGACCGTTCTTCCGTTTGTCAAATT
TGGCACACAGACATTGCATCCTTACACATTTAAGCCTGCTGACAGCGCGCAGAAAAGTAATGAAAGCAGC
ATTTTCGCCTCCCCCGATTCAAAACAAAAGACCGAAAGCGGTGATACGATCACATCGCAGATTGGTAATC
TACCAACCAAAGATGATGCGGTCAAAGCGGGGTTTAAAGATATTGAAAGCTATCTAGAACTTGACCGTGA
CTACACAGTTGACGAGCCTATTAAAATTGCTGACAGTGAAGCTCACACGTTTGTACTAACTCTGGAATAC
CCTGAAAACGGAAATGGCACCGACCGCAGGAACAACACCGACAGGATTCTTGTGGGCAGCTATAGACTTA
AGGTCAAGAAAGATTGCGGCGCTCACCTGGAAAATAGCCTGTACTACACGTTTTCCGAGAGTTATCCGGA
ATATAAGCCGGGTGATAGTAACAGCAAATCACAACCGCTGCGATTCATGGATAAAAGCGAAATACGGATT
GAAAAAACTAGCGCAACGGGGGATTTGTATTATGGTGTGCGCGACAACGGTGATGGAGAGTCAAATAATA
TAGGGCACTTCGAGATTAAAGCCATAATTTCCAAAACGCCCCCCAAGTTTTTTTCTCATATTGTGAAGTG
GACAGAAGAAAGAGTGCGTTCCGCGCTGTACGGCAATAAAGACAAAGCTGGTGGGCAGGAAAGCGTTGTA
GCCAGCATGTACAGGCACATTAGCACGGATGGTCCGTTCAACAGGCTTGTGAATGCATTGCTGATTTTAT
ATGTGATGGTCAGCGCACTTTACTTCTTTTTGGGGTTCTCCAGGGCGTCGATCTTCCAGTTGTTTATCAT
CTTTGCAAAAGTCATAATCGTGGTGTACGTAATACGCCCGGACAGCTGGACCTTTTTTAACGATCATCTG
TTCAAATTGTTTACAGATGGCCCCAAAAGTTTGATTGCCGTCATGACTGGTGGTGTTGGAAACACCGATG
ATTTTGGATTTATGGATGGCATACTATATAGGTTTTCGGTCTCGCAAACGTGGATTCAGCTGCTAGCACT
CATATTTTCTGGCCCTGTGGGGTGGCTCACAGTGGTGCTAATTTTCTGGGGGCTGTTCCTCCTGGTGGAA
TGCATGTTCAGTGCGGTGGTGATATACCTAATATCCATTATGCTGATAGCGCTGTTGTTGTGTATAGCGC
CGTTCTTTTTGATATGCGTGCTGTTTAAACGTACCAAGGCGATATTTGATGCTTGGATAAAGGTATTGTT
ACAAACTGCGATGCAGCCGGTTTTGATCTTCTCTTGCGTTGCCGTGATGGTGCAAGTAGTCAACAGTGTA
ATATATGCGATGCTCAACTTCCAAGTGTGCGAAGCTTGCGTTTTGTCGCTAGACTTGAAAATCGCCACTT
TGTGCGTGCTACGCTTTCTTCTACCAATGGGAATAGTCCCGATCATGCCGGTTAGCGATGTTGTAAGGGA
GTTATACAATACTGGAGAAACGATCCTCATAGGAATACCTGGCCCGCTATTTAACGTGCTAATTTTTGTG
GCCGTGGCCCACGCTACTAGGGACTTTGTGATCACCAGTGGTGAGATGTGTAGTATCATGTTCGGTGCGT
TTACCAACCTGTCCGATGTGGGTGGAAGCGCAGCGCAGGCTCTGTTGAGCGTAGTTGGAATGGATAAAAT
GACTGGACATATGGCGGAACAGCAGAAACATCAGTCCGCGCTCTTCTACAGAGGGGCAGGTGCCGGACGC
GAGGAGAGCTTTGCTTCCAGACTCATGCCTACTTCCCCAGTGGCACAGACTGGTGCCGGTGCACCTGCCA
AGCGCAAGCCTATTGTTGTCCATCCTGCTGATCCTCCGGCTAGCTTTTAG
 Primer design