SecReT4
Protein ID: 56416921
T4SS name [ID]VirB [496]
Gene symbolvirB6
Locus tagAM813
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]747102..749738 [-]
ProductVirB6 protein
Component typeVirB6
UniProt IDQ5PAE0
KEGG IDama:AM813
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.2e-12, Aligned region: 476..706
Protein Sequence: 878 a.a.     [Download]
>gi|56416921|ref|YP_153995.1| VirB6 protein [Anaplasma marginale str. St. Maries]
MRRAVRAIALMVLFVWLPFVPHYAAYSDEPKKEEESDRLVSYRYAEATNPRCGAAATVAEVGAKVIGPSL
GLMITGAVLVKIPLGWTTKAGFALIASNVAIISAAVAASSAYFVCNWSFVRHPVLRFEEGETVTGQSGTP
TVLTEHTSNTGDTSSFKIGNYKECENPHAPDADVKAKWESSGTSGGTDGCSKEFADLNSYFACIAPQKSL
EVAKTLEPVCKDRKFKQVNHYAWPKNRVSSSRYIEVCYRKPLATLFAGAYRALKNQTKSESYTEQIKKGA
YPREGTYGDESMHKTKLAISGAGGDNIGAHVECKVLWAGKEETIHDAQFRAVERGDKLCVDAVSVSKLPL
IPRPEIGCQMRPNSPPVPMCEKSKAVMGEAGTERAGKVVKYDNEKCYSCYVDQACQGTASVHTKSPFPVT
SVLVNCIVGSLKNVLDPTSGGGQKCAHKSTTPGGPNPGFLKVAQKKLKNAVMAALILALILFSIKAMLGG
VQNASELYMTAIKFALVVYFTQGDAMSKSYDYLTKLSIGLSDIVLAAANGGQDICNYKTETYDENFRYLV
PWDRLDCRMMFYLGSQLNGGTGTGVLLTVFLCAGLLIPAILINAKVIICVVAFFAVMMLIFTVIWCVYVF
LLSLIALTVLTIISPLMIPMCLFQVTKGFFDGWTRQLMVYSLYPVILFSFLSLMFTVFDNIYFGELKFQQ
DDITIGSSKRVNFKLTNPKACDDPKMDSNLACMFSTVNFHTKPLVLGLSVTSPEFKETTAAIWTKLGVFV
LVGFLFYHFLSSISYIAGELAGDPRAGVIGSGSFNPRALAGGAMGVASKISNYASGKMSDAGSKMMDRMK
GGGQAGGGGSDKVSGGSSPRSSNAGAGMDSVSGGSSGT
 
Nucleotide Sequence: 2637 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c749738-747102 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGCGTAGAGCGGTCAGGGCAATAGCACTGATGGTCCTATTTGTGTGGCTGCCATTTGTGCCGCATTATG
CCGCATATTCTGATGAGCCTAAGAAGGAGGAAGAGAGTGACCGCTTGGTGAGCTACAGATACGCCGAGGC
CACTAACCCCCGTTGTGGTGCTGCGGCCACGGTAGCTGAAGTAGGTGCTAAAGTTATAGGTCCGTCGCTG
GGGCTTATGATAACCGGCGCAGTATTAGTAAAGATACCCCTTGGTTGGACCACCAAGGCCGGGTTCGCGC
TAATTGCCTCAAATGTGGCGATTATATCCGCAGCTGTTGCCGCGTCCTCGGCATATTTTGTCTGTAATTG
GAGCTTCGTACGCCACCCTGTTTTGCGCTTCGAGGAAGGAGAAACAGTAACGGGTCAAAGCGGCACCCCA
ACGGTGCTGACGGAACACACCTCTAATACTGGTGACACGAGCAGTTTCAAAATTGGAAATTACAAGGAGT
GCGAGAATCCGCATGCGCCAGATGCGGATGTGAAAGCAAAGTGGGAAAGCAGCGGCACGTCAGGTGGCAC
AGATGGATGCTCCAAGGAATTTGCCGATTTGAACAGTTATTTCGCGTGCATTGCACCGCAGAAGAGCTTG
GAAGTAGCCAAAACGCTGGAGCCCGTGTGTAAGGATAGGAAGTTCAAGCAAGTTAATCACTATGCGTGGC
CAAAGAATCGGGTCTCCAGCTCCCGCTACATCGAAGTCTGCTATCGCAAACCGCTTGCAACACTATTTGC
AGGTGCGTACAGGGCGCTGAAAAATCAAACGAAAAGCGAGAGCTATACTGAACAAATAAAAAAGGGAGCC
TATCCGCGTGAGGGCACATACGGTGACGAGAGCATGCATAAAACCAAGCTCGCCATTTCTGGGGCTGGAG
GTGACAACATTGGCGCACACGTAGAATGTAAGGTGCTTTGGGCTGGAAAAGAGGAGACTATACATGATGC
CCAATTTCGCGCTGTTGAGCGGGGCGATAAGCTCTGCGTGGATGCGGTGAGCGTAAGTAAGTTACCACTT
ATTCCCAGGCCGGAGATAGGCTGTCAGATGCGTCCTAATTCGCCCCCGGTTCCTATGTGCGAGAAGTCAA
AGGCAGTAATGGGTGAAGCAGGCACAGAAAGGGCTGGTAAAGTTGTCAAATACGACAATGAAAAATGCTA
CAGTTGTTACGTGGACCAGGCATGCCAAGGCACTGCTTCAGTGCACACGAAGTCTCCGTTTCCTGTTACC
TCTGTGCTTGTAAACTGCATAGTTGGATCTTTGAAGAATGTGCTGGACCCCACTAGTGGTGGTGGCCAAA
AGTGTGCGCACAAATCCACTACTCCGGGGGGCCCAAACCCTGGATTCTTGAAGGTGGCACAGAAGAAGCT
CAAGAACGCTGTTATGGCTGCGTTGATACTTGCACTGATTTTGTTCTCGATCAAAGCTATGCTCGGTGGG
GTGCAGAACGCATCTGAACTGTATATGACGGCGATAAAATTTGCCTTGGTTGTCTACTTTACCCAGGGTG
ATGCGATGAGCAAGTCATATGACTACCTGACAAAACTTTCGATTGGTCTCTCAGACATTGTGCTGGCTGC
CGCCAATGGGGGGCAAGACATTTGCAACTACAAGACAGAGACTTACGATGAGAATTTCCGATACCTGGTG
CCATGGGATAGGTTGGACTGCAGGATGATGTTTTACCTTGGTAGCCAGCTCAATGGGGGGACAGGGACCG
GCGTTTTACTGACTGTGTTCCTTTGTGCCGGTCTGTTGATACCCGCAATCCTCATAAACGCCAAGGTGAT
AATATGTGTTGTAGCGTTCTTTGCGGTGATGATGCTGATATTTACCGTGATATGGTGTGTGTATGTGTTC
CTACTGTCATTAATCGCCCTTACGGTTCTTACAATCATATCCCCCCTCATGATACCCATGTGCCTTTTCC
AGGTTACCAAGGGATTCTTTGATGGGTGGACCAGACAGCTTATGGTGTACTCTTTGTATCCGGTAATATT
GTTTTCGTTCCTGTCGCTGATGTTTACTGTTTTTGACAACATATACTTTGGGGAGTTGAAGTTTCAGCAA
GACGACATAACGATAGGCAGCAGTAAGAGGGTGAACTTTAAGCTTACAAACCCTAAAGCCTGCGATGACC
CGAAGATGGACAGCAATCTGGCATGCATGTTTAGCACAGTAAACTTCCATACAAAACCGCTGGTGCTTGG
GCTGTCAGTTACAAGTCCAGAGTTTAAGGAGACAACTGCTGCAATTTGGACCAAGCTTGGGGTGTTTGTA
CTTGTAGGGTTCTTATTCTATCACTTCTTGTCTTCCATATCTTACATCGCCGGGGAACTTGCGGGAGATC
CGAGGGCTGGTGTTATCGGTTCGGGTAGCTTCAATCCTAGAGCGCTTGCCGGTGGGGCTATGGGTGTCGC
TTCCAAGATCAGCAACTATGCTTCGGGCAAGATGTCTGATGCAGGAAGCAAGATGATGGATCGCATGAAG
GGAGGAGGCCAGGCAGGGGGTGGTGGATCCGATAAGGTCTCGGGTGGCAGCTCCCCTAGGAGTAGTAATG
CAGGTGCCGGTATGGATTCTGTGTCTGGAGGGTCGTCTGGGACGTAA
 Primer design