SecReT4
Protein ID: 56416923
T4SS name [ID]VirB [496]
Gene symbolvirB3
Locus tagAM815
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]752143..752439 [-]
Producttype IV secretion system protein VirB3
Component typeVirB3
UniProt IDQ5PAD8
KEGG IDama:AM815
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 4.9e-15, Aligned region: 6..90
Protein Sequence: 98 a.a.     [Download]
>gi|56416923|ref|YP_153997.1| type IV secretion system protein VirB3 [Anaplasma marginale str. St. Maries]
MSSGSVKTDQLFKGLTRPTMLFGVSYTFAILNFMISIMLFMYSNDFRVLLVLAPGMHAIGFAASAKDPLF
MDLFVIKMQKCSKCLNRFYHNANSYDVM
 
Nucleotide Sequence: 297 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c752439-752143 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTCGTCCGGTAGCGTAAAGACGGATCAGCTGTTTAAAGGGCTCACAAGGCCCACTATGCTTTTCGGTG
TAAGCTATACATTTGCGATACTGAATTTCATGATCTCTATCATGCTTTTCATGTACAGCAACGACTTTAG
AGTGTTGCTCGTTCTGGCCCCGGGCATGCACGCCATAGGCTTCGCTGCATCTGCGAAAGACCCGTTGTTC
ATGGATCTGTTTGTCATCAAAATGCAAAAGTGCAGCAAGTGTCTTAATCGTTTCTATCACAATGCCAATT
CTTACGATGTGATGTAG
 Primer design