SecReT4
Protein ID: 56417061
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM989
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]900783..901157 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PA00
KEGG IDama:AM989
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.7e-20, Aligned region: 5..97
Protein Sequence: 124 a.a.     [Download]
>gi|56417061|ref|YP_154135.1| hypothetical protein AM989 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLALGILHGVPAGADTQTAKDDDTATVVICNVIRFVQKLGLPIMTGVILGSSIMAIFG
KLAWPAIVMLVVFTAIFFGAGKLMAKFASGLGDVGGGTKAESFDCSSYKEVKAK
 
Nucleotide Sequence: 375 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c901157-900783 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CAGGGGCTGATACTCAGACTGCTAAGGATGACGATACAGCGACTGTTGTTATATGTAACGTTATACGGTT
TGTGCAGAAGCTTGGGCTTCCTATCATGACTGGAGTGATACTAGGTTCTAGCATTATGGCTATCTTTGGT
AAGCTTGCATGGCCTGCTATTGTGATGCTAGTTGTATTCACAGCTATATTCTTTGGTGCTGGTAAGCTCA
TGGCTAAATTTGCTTCCGGGTTGGGCGATGTGGGAGGAGGCACGAAGGCCGAGAGCTTTGACTGTTCCAG
TTATAAGGAAGTCAAGGCCAAGTAA
 Primer design