SecReT4
Protein ID: 56417062
T4SS name [ID]VirB [496]
Gene symbolorfY
Locus tagAM990
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]901157..901468 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9Z9
KEGG IDama:AM990
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9e-14, Aligned region: 2..78
Protein Sequence: 103 a.a.     [Download]
>gi|56417062|ref|YP_154136.1| hypothetical protein AM990 [Anaplasma marginale str. St. Maries]
MVALIWLFITAGSTNADTISSTNIADDTATKVICDVIVFVQKLGLPIMTGVILGSSIMAIFGKLAWPAIV
MLVVFTAIGKLMATVLRVIPVSARVDVEVLGEW
 
Nucleotide Sequence: 312 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c901468-901157 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGGTAGCCCTGATATGGTTATTCATCACAGCAGGTTCTACTAATGCCGATACTATCAGCAGTACTAACA
TTGCTGACGATACAGCTACCAAGGTTATTTGTGACGTCATTGTCTTCGTGCAGAAGCTGGGATTACCCAT
CATGACAGGGGTGATACTAGGTTCTAGCATTATGGCTATCTTTGGTAAGCTTGCATGGCCTGCTATTGTA
ATGCTGGTTGTATTTACAGCTATAGGTAAGCTTATGGCCACTGTATTGAGGGTAATACCAGTTAGTGCAA
GGGTGGACGTAGAGGTTTTGGGAGAGTGGTGA
 Primer design