SecReT4
Protein ID: 56417100
T4SS name [ID]VirB [496]
Gene symbolvirB4
Locus tagAM1053
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]956209..958638 [-]
ProductVirB4 protein
Component typeVirB4
UniProt IDQ5P9W1
KEGG IDama:AM1053
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 3.7e-23, Aligned region: 209..406
AAA_10 [PF12846], Evalue: 4.5e-09, Aligned region: 463..719
Protein Sequence: 809 a.a.     [Download]
>gi|56417100|ref|YP_154174.1| VirB4 protein [Anaplasma marginale str. St. Maries]
MSFIDSFVRKFRLKKRGDEDQGSEEKSSATVEEVHSSSYAAGGADSYVEFIAPACHYNEETLLNKSGGLV
QIIRIEDYADSSGLGSLRDAIRTVISNVRDPSIAFWLYTVREECKFKLDWHETRDFSDSLHSLYEDSIGS
RRTYANEVYIAVVTQPLREKLDGMISALTFGRVKKRHKSFLASKVQQLSRVTSAMVAELQCFSARKLGVV
RCEDGKWRSELLEFLSYLVTLRRGERFLEFRDSAHTIAAGCGLAVGFNTLKISDQEGARYGAILGVKEYT
GESLDAIDMCLQQECEFVITEVIQFVPSVQVKDAYRRQTELLEISGDAELAKIARLEEVMSTDESSIGDC
CKRKVSCMVISNSVPSLKKDIKKMVAAFSELGAIVVRVDLALEDDFWANMPGSFRYVLGMRFAMVKAACT
FAMTHHFPSGALKGGRWHEAITLFFSNQNLPYFFSFHAGDKGHTLCLGPQDSHMTLIMNFIISESRRLRV
KSVVFDYSGKSIIFATAINGQYNRIDDRQGKVTQFFNPFNVHDTPINREIAVGVVERMAGTLEPPSEAIK
LAAREVVDKIFSIPMESRTPDKVRECIEMLGESARAWWGAQGAFSRLISDTTEIELDGEFVVINVGMLAG
KQECMGAILYFLLRSLENRFNGEPTILVMYEAWVMDVVFPDESEFDAWMERLTARNVVVVFAAENIRAIS
TSKLIRYASKHIETRIFMPNVIIGSQQQVRVFGLSKEEVDVMLQIPHHEGHFFIKQGSSSVVLALKLRDK
ETRVLSANRTTIKLMYEAIAEKGKDWLPAFHAKCDKLAQ
 
Nucleotide Sequence: 2430 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c958638-956209 Anaplasma marginale str. St. Maries chromosome, complete genome
GTGTCTTTCATAGATAGTTTTGTGCGCAAATTTCGCCTGAAGAAAAGGGGCGATGAGGATCAAGGCTCTG
AAGAGAAGAGCAGTGCTACAGTTGAGGAGGTACACAGCTCCTCCTATGCAGCAGGTGGGGCGGATTCCTA
CGTGGAGTTCATAGCACCCGCCTGCCACTACAACGAAGAGACGCTGCTGAACAAAAGTGGGGGTCTGGTA
CAAATAATACGGATAGAAGACTATGCCGACAGTTCAGGTTTGGGGTCTCTCAGGGATGCTATAAGGACTG
TTATATCGAACGTGCGGGATCCGAGCATTGCATTTTGGCTATACACTGTTAGGGAAGAGTGCAAATTTAA
ACTTGATTGGCACGAGACGCGGGACTTTTCTGATTCTTTGCACTCCCTGTACGAGGACTCTATAGGCTCA
AGGCGTACTTACGCTAATGAGGTATACATTGCTGTGGTGACTCAGCCTCTGCGCGAGAAGCTGGATGGCA
TGATCAGTGCGCTGACGTTCGGCCGAGTCAAAAAGAGACATAAGAGCTTTTTGGCCTCTAAAGTGCAACA
GTTATCCAGGGTAACTTCCGCCATGGTGGCAGAACTACAATGTTTTTCTGCTAGAAAGCTTGGGGTGGTC
CGCTGCGAAGACGGAAAATGGCGGTCTGAATTACTGGAGTTTCTGAGCTATTTGGTTACCTTAAGACGTG
GTGAGCGATTCTTAGAATTCCGTGACAGCGCGCATACCATTGCCGCAGGATGTGGTCTGGCTGTTGGGTT
TAACACGTTAAAGATTTCGGATCAAGAAGGGGCAAGATACGGAGCAATTCTTGGCGTCAAGGAATACACA
GGTGAATCTCTAGATGCGATTGACATGTGTTTACAGCAAGAGTGCGAGTTCGTCATAACAGAAGTGATAC
AATTCGTGCCGAGTGTGCAGGTCAAGGATGCGTACAGGAGGCAGACCGAACTGTTGGAGATAAGCGGAGA
CGCGGAACTGGCAAAGATTGCACGTCTGGAAGAGGTTATGTCCACCGACGAAAGCTCAATTGGTGATTGT
TGTAAGCGGAAAGTGAGCTGCATGGTCATCTCAAACAGTGTCCCATCCCTCAAGAAGGACATAAAGAAAA
TGGTTGCCGCGTTTTCAGAGTTGGGTGCAATCGTGGTAAGGGTTGACTTGGCCCTGGAAGATGACTTCTG
GGCCAACATGCCCGGTAGTTTCCGCTACGTTCTTGGGATGCGGTTTGCAATGGTGAAAGCCGCATGCACT
TTTGCTATGACGCACCACTTTCCTTCGGGTGCGCTTAAGGGAGGGCGATGGCACGAGGCCATTACGCTGT
TTTTTTCCAACCAAAACCTGCCGTATTTCTTTAGCTTCCACGCGGGGGATAAGGGGCACACGCTTTGCCT
AGGTCCGCAGGATTCACACATGACCTTAATAATGAATTTCATAATTTCAGAGTCCAGAAGGTTGCGCGTG
AAGTCTGTGGTGTTCGACTATAGCGGAAAATCCATTATTTTTGCTACTGCAATTAACGGGCAGTACAACA
GGATAGATGATAGGCAAGGCAAAGTAACCCAGTTCTTCAATCCGTTCAATGTGCACGATACCCCGATTAA
TCGCGAGATAGCTGTTGGGGTTGTGGAAAGAATGGCCGGTACGCTTGAGCCGCCCAGCGAGGCAATCAAA
CTCGCTGCCAGAGAGGTTGTTGATAAGATATTCTCAATCCCCATGGAGTCCCGTACGCCGGACAAAGTGC
GGGAATGCATAGAAATGTTAGGGGAGTCAGCGCGTGCTTGGTGGGGGGCCCAGGGGGCTTTTTCGCGCCT
AATATCAGACACGACGGAAATAGAGTTGGATGGGGAGTTTGTGGTAATTAACGTTGGCATGCTTGCTGGC
AAACAGGAGTGTATGGGTGCGATATTGTATTTTCTCCTGCGTTCACTCGAAAACCGCTTTAACGGAGAGC
CGACCATTCTTGTGATGTATGAGGCCTGGGTCATGGATGTGGTGTTTCCGGATGAGAGCGAGTTTGATGC
GTGGATGGAGAGGCTTACCGCACGAAACGTTGTGGTGGTGTTTGCAGCAGAAAACATTCGTGCTATCTCC
ACAAGTAAGCTTATAAGATATGCTAGCAAACACATCGAAACGCGGATTTTCATGCCTAATGTTATCATAG
GCAGCCAGCAGCAGGTTAGGGTGTTTGGCCTGTCCAAAGAAGAAGTGGATGTCATGTTGCAGATACCCCA
TCATGAGGGGCATTTCTTCATCAAACAAGGCAGTTCATCGGTAGTTTTGGCGCTGAAGCTGCGAGACAAA
GAGACGAGAGTGCTATCCGCAAATAGAACGACAATAAAACTCATGTACGAAGCGATTGCAGAGAAGGGCA
AGGATTGGCTACCTGCATTTCATGCAAAGTGCGATAAACTCGCGCAGTAA
 Primer design