SecReT4
Protein ID: 56417101
T4SS name [ID]VirB [496]
Gene symbol-
Locus tagAM1054
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]958771..959145 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9W0
KEGG IDama:AM1054
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-19, Aligned region: 5..102
Protein Sequence: 124 a.a.     [Download]
>gi|56417101|ref|YP_154175.1| hypothetical protein AM1054 [Anaplasma marginale str. St. Maries]
MLKAFLTTVSVFVFTLLSFSSEASSVRAMSQGSANAANGEVVSKVICNVVVFVQKLGLPIMTGVILGSSI
MAVFGRLAWPAIVMLVVFTAIFFGAGKLISKFAGGIAELGADDFDCRVLAGTTI
 
Nucleotide Sequence: 375 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c959145-958771 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGAAAGCCTTTTTGACAACAGTATCTGTGTTTGTCTTCACGTTACTATCGTTCAGCTCTGAAGCCT
CAAGCGTGCGCGCTATGTCCCAGGGTTCAGCAAATGCGGCGAATGGGGAAGTGGTATCAAAAGTTATATG
CAACGTTGTGGTGTTCGTGCAAAAGTTGGGGTTGCCTATAATGACGGGAGTTATACTGGGCTCGAGCATC
ATGGCGGTCTTCGGTAGGCTGGCATGGCCTGCTATTGTGATGCTAGTTGTATTTACAGCCATATTCTTTG
GTGCAGGGAAGTTGATTTCAAAATTTGCCGGTGGCATTGCAGAATTGGGTGCTGATGATTTTGACTGTAG
AGTGCTTGCTGGCACGACTATATAG
 Primer design