SecReT4
Protein ID: 56417102
T4SS name [ID]VirB [496]
Gene symbol-
Locus tagAM1055
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]959418..959795 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9V9
KEGG IDama:AM1055
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9.5e-24, Aligned region: 8..110
Protein Sequence: 125 a.a.     [Download]
>gi|56417102|ref|YP_154176.1| hypothetical protein AM1055 [Anaplasma marginale str. St. Maries]
MGVYGMSRFVKFFFRAACTLLVALSIGTADCAFASDKGKTGGQDDKKDVATTVICNVILFVQKLGLPIMT
GVILGASVMAVFGRLAWPAIAMLVVFTAIFFGASKLISKFAKGITELDADNFDCK
 
Nucleotide Sequence: 378 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c959795-959418 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGGGGGTTTATGGAATGTCACGATTTGTAAAATTTTTCTTTCGGGCAGCATGTACACTATTAGTTGCGC
TCAGCATCGGTACCGCAGACTGCGCCTTCGCGAGCGATAAAGGGAAGACGGGGGGACAGGATGATAAAAA
AGATGTTGCCACAACAGTGATATGTAATGTCATCCTCTTTGTGCAAAAGCTGGGGTTACCGATCATGACC
GGTGTTATTCTAGGCGCAAGTGTAATGGCGGTTTTCGGTAGGCTGGCATGGCCGGCCATAGCAATGTTGG
TTGTATTTACTGCAATATTCTTTGGCGCAAGTAAGCTCATAAGCAAATTTGCGAAGGGGATCACCGAGCT
AGACGCCGATAACTTTGACTGCAAGTAA
 Primer design