SecReT4
Protein ID: 56417103
T4SS name [ID]VirB [496]
Gene symbol-
Locus tagAM1056
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]960582..961172 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9V8
KEGG IDama:AM1056
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.1e-16, Aligned region: 116..183
GRP [PF07172], Evalue: 9.5e-05, Aligned region: 29..118
Protein Sequence: 196 a.a.     [Download]
>gi|56417103|ref|YP_154177.1| hypothetical protein AM1056 [Anaplasma marginale str. St. Maries]
MFTRERKVTCCLLLKRFGGAMYAVAPKVLLFLVFLFVVDSAHAASNKNAGNNKSKSTSSKSVSGSKSKSV
SSSKSKSAGSTNVGTANQFPALGGGGSGSGNTGSGSGGGTGGGGGGANDDMVAGKVICNVISFVRAIGLP
IMTGVILGSSIMAIFGRLAWPAIAILVVFTGVFFGADKLVKKFADGVGPTSVFSCT
 
Nucleotide Sequence: 591 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c961172-960582 Anaplasma marginale str. St. Maries chromosome, complete genome
TTGTTTACTAGGGAGAGGAAAGTGACTTGTTGTTTGTTATTGAAGCGTTTCGGAGGTGCTATGTACGCCG
TAGCGCCGAAGGTATTGTTATTTTTGGTGTTCCTGTTCGTTGTCGATTCGGCGCATGCTGCTAGTAATAA
GAATGCTGGCAATAATAAGAGTAAGAGCACGAGCAGTAAGAGTGTAAGCGGTAGTAAGAGTAAAAGTGTG
AGCAGTAGTAAGAGTAAAAGTGCCGGCAGTACGAATGTCGGTACTGCCAATCAGTTTCCTGCTTTGGGTG
GTGGAGGCTCAGGTAGTGGTAATACAGGCTCAGGTAGTGGAGGAGGCACAGGTGGCGGCGGTGGCGGCGC
CAACGATGATATGGTTGCCGGCAAAGTCATCTGTAATGTAATCAGTTTCGTTAGGGCTATAGGGTTGCCA
ATCATGACTGGGGTGATATTAGGCTCTAGCATCATGGCAATTTTCGGCAGATTGGCATGGCCTGCAATAG
CCATACTAGTAGTGTTTACCGGAGTGTTTTTTGGAGCGGATAAACTGGTTAAGAAATTTGCCGATGGTGT
TGGTCCGACATCCGTATTTTCGTGCACATAG
 Primer design