SecReT4
Protein ID: 56417106
T4SS name [ID]VirB [496]
Gene symbolorfY
Locus tagAM1059
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]962297..962566 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9V5
KEGG IDama:AM1059
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.2e-09, Aligned region: 6..72
Protein Sequence: 89 a.a.     [Download]
>gi|56417106|ref|YP_154180.1| hypothetical protein AM1059 [Anaplasma marginale str. St. Maries]
MFNFARRYLAPAMVALIWLFITAGSTNADTISSTNTADDTATKVICDVIVFVQKLGLPIMTGVVLGSGVM
AWHTCMACYCNAGCVYSHR
 
Nucleotide Sequence: 270 bp     [Download]
>gi|56416370|ref|NC_004842.2|:962297-962566 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTCAACTTTGCACGAAGATACCTAGCTCCTGCTATGGTAGCCCTGATATGGTTATTCATCACAGCAG
GTTCTACTAATGCCGATACTATCAGCAGTACTAACACTGCTGACGATACAGCTACCAAGGTTATTTGTGA
CGTCATTGTCTTCGTGCAGAAGCTGGGATTACCCATCATGACAGGGGTGGTACTAGGTTCTGGCGTCATG
GCTTGGCACACTTGCATGGCCTGCTATTGTAATGCTGGTTGTGTGTACAGCCATAGGTAA
 Primer design