SecReT4
Protein ID: 56417107
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM1061
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]962633..963028 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9V4
KEGG IDama:AM1061
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9.1e-20, Aligned region: 6..102
Protein Sequence: 131 a.a.     [Download]
>gi|56417107|ref|YP_154181.1| hypothetical protein AM1061 [Anaplasma marginale str. St. Maries]
MVMLLKLRFLLIAVVLALGILHGVPAGASKSSEGAQTADDTATIVICNVIRFVQKLGLPIMTGVILGSSI
MAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAAGLGDVGGGTDASKFDCASHKGSSGAAG
 
Nucleotide Sequence: 396 bp     [Download]
>gi|56416370|ref|NC_004842.2|:962633-963028 Anaplasma marginale str. St. Maries chromosome, complete genome
GTGGTGATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTG
TACCTGCTGGGGCTAGTAAGTCCAGCGAGGGTGCTCAGACTGCTGATGATACAGCGACTATTGTTATATG
TAACGTTATACGGTTTGTGCAGAAGCTGGGACTACCCATCATGACTGGAGTGATACTAGGTTCTAGCATT
ATGGCTATCTTTGGTAAGCTTGCATGGCCTGCTATTGTGATGTTGGTTGTATTTACAGCTATATTCTTTG
GTGCTGGTAAGCTTATGGCTAAGTTTGCTGCTGGATTGGGCGATGTGGGAGGAGGAACGGATGCCAGTAA
GTTTGACTGTGCCAGTCATAAAGGTAGCAGTGGTGCTGCTGGGTAG
 Primer design