SecReT4
Protein ID: 56417174
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM1149
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]1034507..1034896 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9N7
KEGG IDama:AM1149
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.5e-19, Aligned region: 6..101
Protein Sequence: 129 a.a.     [Download]
>gi|56417174|ref|YP_154248.1| hypothetical protein AM1149 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLALGILHGVPAGAENVQAGQAAKDDDTATVVICNVIRFVQKLGLPIMTGVILGSSIM
AIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAAGLSGEGVKDAGSFDCSSYKGTAQSNR
 
Nucleotide Sequence: 390 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c1034896-1034507 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CAGGGGCTGAGAATGTTCAGGCTGGTCAGGCTGCTAAGGATGATGACACAGCAACCGTTGTTATATGCAA
TGTTATACGGTTTGTGCAGAAGCTGGGACTACCCATCATGACTGGAGTGATACTAGGTTCTAGCATTATG
GCTATCTTTGGTAAGCTTGCATGGCCTGCTATTGTAATGCTGGTTGTATTTACAGCTATATTCTTTGGTG
CTGGTAAGCTTATGGCTAAATTTGCTGCTGGGTTGAGTGGTGAGGGTGTGAAGGATGCCGGTAGCTTTGA
CTGTTCCAGTTATAAAGGCACTGCCCAAAGTAACCGATAG
 Primer design