SecReT4
Protein ID: 56417285
T4SS name [ID]VirB [496]
Gene symbolvirD4
Locus tagAM1312
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]1154957..1157377 [-]
Producttype IV secretion system protein VirB8
Component typeVirD4
UniProt IDQ5P9C6
KEGG IDama:AM1312
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.6e-150, Aligned region: 124..568
TraG-D_C [PF12696], Evalue: 1.7e-26, Aligned region: 407..529
TrwB_AAD_bind [PF10412], Evalue: 1.2e-25, Aligned region: 240..543
Protein Sequence: 806 a.a.     [Download]
>gi|56417285|ref|YP_154359.1| type IV secretion system protein VirB8 [Anaplasma marginale str. St. Maries]
MHSSSNHIRNILVFFFGMFFLLEFCFYISGALFVLSMWGLEYLDFNALNPSISDFPMRLWPTIFNYIHGW
WADPKLYGVSNSLKLWLSFAAPLCIVGTVFWNLRHILLEWRPFRKKEALHGDSRWASERDIRKIGLRSRK
GLLLGKDQRGYLVADGYQHALLFAPTGSGKGVGFVIPNLLFWEDSLVVHDIKLENYDITSGWRKKIGQEV
YVWNPAQPDGVSHCYNPLDWISKKPGQMVDDVQKIANLIMPEQDFWYNEARSLFVGVVLYLLAVPEKVKS
FGEVVRTMRSDDVVYNLAVVLDTIGKKIHPVAYMNIAAFLQKADKERSGVVSTMNSSLELWANPLIDTAT
ASSDFNIQEFKKKKITVYVGLTPDNLTRLRPLMQVFYQQATEFLCRALPSDDEPYGVLFMMDEFPTLGKM
EQFQTGIAYFRGYRVRLFLIIQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETANLISQLIGNKTVS
QESLNRPKFLDLNPASRSLHISDTQRALLLPQEVIMLPKDEQILLIESTYPIKSKKIKYYEDKFFTKKLL
KSTFVPTQEPYDPDAARGGVDTVAEDVPTSEEGEQQAAIAHEESAQEAQQPQEQHGDEAGYDEFGDYPQD
YDYSSEDDEYMEGLDDIEGEDVPLNGEGLDDIGDEDSYPEDHVSDEGHPEEDELSAYKEEPTDSELQDAE
DGYGGGDEEPYYEENDGGEPYEADEIRGSEGGVTDVYPEEDEPLAYEEEPTDGELQDAEDEYGSGDEEPY
YEESGGDEPYGEDETYDDEDTQPPRRDGKQRDDDNP
 
Nucleotide Sequence: 2421 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c1157377-1154957 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGCACAGTAGCTCTAATCACATACGTAACATTTTGGTGTTCTTCTTCGGGATGTTTTTCCTCCTGGAGT
TCTGTTTTTACATCTCGGGGGCACTTTTTGTGCTTTCAATGTGGGGTCTTGAGTACCTGGATTTCAACGC
TTTGAACCCCAGTATATCAGACTTCCCCATGAGGTTATGGCCAACAATTTTCAATTACATCCACGGGTGG
TGGGCCGACCCCAAGTTATATGGGGTGTCTAATTCGCTGAAGTTGTGGTTATCCTTCGCGGCGCCGTTGT
GTATAGTGGGCACTGTCTTTTGGAATCTGCGGCACATTCTCCTGGAGTGGCGACCTTTTCGAAAGAAGGA
GGCCTTGCATGGTGATTCCAGATGGGCGTCGGAGCGCGATATACGTAAAATTGGCCTCAGAAGCAGGAAG
GGTTTGCTTCTTGGAAAAGACCAAAGGGGGTATTTAGTAGCAGATGGCTACCAGCACGCATTGCTTTTTG
CGCCTACAGGGTCAGGTAAAGGTGTGGGGTTTGTAATACCCAATCTTCTGTTCTGGGAAGACTCGCTCGT
GGTGCATGACATCAAGCTGGAGAACTACGACATCACGAGTGGGTGGCGCAAGAAGATCGGGCAGGAAGTT
TACGTGTGGAACCCGGCACAGCCCGACGGCGTTAGCCACTGTTATAACCCTCTAGACTGGATTAGCAAAA
AGCCCGGCCAAATGGTGGATGACGTGCAAAAAATTGCGAACCTCATCATGCCTGAGCAAGATTTCTGGTA
CAACGAGGCGCGGAGTCTTTTCGTCGGCGTTGTTTTGTATCTGCTTGCAGTGCCGGAAAAGGTCAAATCA
TTTGGTGAAGTCGTGCGCACAATGCGCAGTGACGATGTGGTTTATAACCTGGCCGTGGTTTTGGATACCA
TAGGGAAAAAAATCCATCCAGTAGCATATATGAACATTGCGGCCTTCCTCCAGAAGGCCGATAAGGAGCG
GTCAGGTGTGGTCTCAACAATGAACTCATCCCTGGAACTGTGGGCCAACCCCTTGATTGACACCGCAACC
GCGTCTAGTGACTTCAACATTCAGGAGTTCAAGAAAAAGAAGATCACAGTATACGTGGGCCTCACCCCAG
ATAACCTGACCAGGCTCAGGCCTCTAATGCAGGTATTCTATCAGCAGGCGACCGAGTTTTTGTGTAGGGC
GTTGCCATCGGACGATGAGCCCTATGGGGTTCTGTTCATGATGGATGAGTTCCCCACGCTAGGAAAAATG
GAGCAATTCCAAACCGGTATTGCGTACTTCCGCGGTTATAGAGTTAGGCTGTTCTTGATAATACAAGATA
CCGAACAGCTGAAGGGTATATACGAAGAAGCGGGTATGAACTCCTTCCTCTCAAACTCTACTTATAGGAT
CACGTTTGCGGCAAATAATATTGAAACTGCAAACTTGATTTCTCAGCTCATAGGTAACAAAACCGTGAGT
CAGGAATCGCTGAATAGGCCGAAATTTTTGGATTTGAATCCTGCATCGCGTTCTCTGCACATTTCAGATA
CTCAACGGGCGCTGTTGCTTCCACAGGAAGTGATCATGCTACCGAAAGATGAGCAGATTTTATTGATCGA
ATCTACGTATCCGATCAAATCGAAAAAGATTAAGTACTATGAGGATAAGTTTTTCACTAAGAAGCTACTC
AAGAGCACTTTTGTCCCGACGCAGGAACCTTATGATCCAGATGCGGCACGGGGAGGAGTGGACACAGTCG
CTGAGGATGTGCCTACATCTGAAGAAGGAGAGCAGCAGGCTGCCATTGCTCATGAAGAAAGCGCTCAGGA
GGCGCAGCAACCCCAAGAACAACATGGTGATGAGGCTGGGTACGACGAATTCGGAGATTATCCACAAGAC
TATGACTACAGCTCAGAAGATGATGAGTACATGGAAGGTCTGGATGACATAGAAGGAGAGGATGTACCAC
TAAACGGAGAAGGCCTGGACGATATAGGTGACGAAGACAGCTACCCGGAAGATCACGTTAGCGACGAAGG
ACATCCGGAAGAGGATGAACTCTCTGCGTATAAAGAAGAGCCCACCGATAGTGAGCTGCAAGATGCCGAA
GATGGGTATGGTGGCGGAGATGAAGAGCCGTATTACGAGGAAAATGACGGTGGTGAGCCGTATGAGGCAG
ATGAAATACGCGGTTCAGAAGGCGGGGTCACTGACGTGTATCCGGAGGAGGATGAACCCCTAGCATATGA
AGAGGAGCCCACTGATGGTGAGCTGCAAGATGCCGAAGACGAGTATGGCAGCGGAGATGAAGAGCCGTAT
TATGAAGAAAGTGGCGGCGATGAGCCGTACGGGGAAGACGAAACATACGATGACGAAGATACACAACCCC
CCCGTCGCGACGGCAAGCAGCGTGATGATGACAACCCGTAA
 Primer design