SecReT4
Protein ID: 56417286
T4SS name [ID]VirB [496]
Gene symbolvirB11
Locus tagAM1313
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]1157425..1158438 [-]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ5P9C5
KEGG IDama:AM1313
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2e-87, Aligned region: 17..317
Protein Sequence: 337 a.a.     [Download]
>gi|56417286|ref|YP_154360.1| type IV secretion system ATPase VirB11 [Anaplasma marginale str. St. Maries]
MLCAHMTAGYAALETYLEPLQSIFAEDGVNEISINRECEVWVENRGDIRCERIESLTLSHLKALGRLVAQ
ATEQKLSEETPLLSASLPNGFRVQVVFPPACEGDKVVFSIRKPSTVQLSLDDYEKMGAFSHVAQQGRKAM
DVNKQLSELLDSGDIKSFIELAVLSKKNIIVSGGTSTGKTTFTNAALRVIPKDERIITVEDSREIALDHP
NRVHLLASKGGQGRAKVSTQDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADTPRMA
VEQLKLMVMQASLGLPPDQIVSYITNIVDVIIQLKRESGGVRHVAEIMFTKCSQGND
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c1158438-1157425 Anaplasma marginale str. St. Maries chromosome, complete genome
GTGTTGTGTGCGCATATGACAGCAGGATACGCAGCGTTAGAAACATACTTGGAGCCCCTGCAGAGCATAT
TCGCGGAGGATGGGGTCAATGAGATCTCGATCAACAGAGAATGCGAGGTATGGGTAGAGAACAGGGGCGA
TATACGGTGTGAGAGGATTGAAAGTCTAACTCTGTCGCATCTAAAAGCACTCGGCAGGTTGGTAGCACAA
GCAACCGAGCAGAAATTGAGTGAGGAAACGCCTTTGCTGTCGGCTTCTTTGCCCAACGGCTTCCGCGTGC
AGGTGGTGTTTCCCCCCGCTTGCGAGGGTGATAAAGTCGTATTTTCCATAAGAAAGCCATCGACGGTGCA
GTTGTCGCTCGATGATTATGAAAAAATGGGTGCGTTCTCCCATGTGGCCCAGCAGGGCCGCAAGGCTATG
GACGTAAACAAGCAGCTTAGTGAGCTCCTGGATAGCGGGGATATCAAATCTTTCATAGAGCTTGCGGTGC
TGAGCAAAAAAAACATAATCGTCAGTGGAGGTACGTCCACTGGGAAAACTACGTTCACAAACGCGGCGCT
GCGGGTCATCCCAAAGGATGAAAGGATAATAACGGTGGAAGACTCTAGAGAAATAGCGCTAGACCACCCC
AACAGGGTACATCTATTGGCATCCAAGGGCGGCCAGGGGCGCGCTAAGGTCTCTACTCAAGATCTTATAG
AGGCCTGCTTGCGTCTTCGTCCAGATAGAATAATTGTTGGGGAGCTCAGGGGGGCTGAGGCGTTTAGCTT
TCTCAGAGCCATAAATACTGGGCACCCGGGTTCCATCTCAACCTTGCATGCAGACACGCCTAGAATGGCT
GTAGAGCAGCTGAAACTTATGGTAATGCAAGCGAGTCTAGGGTTGCCGCCAGACCAAATAGTAAGTTACA
TTACCAACATAGTAGACGTAATTATACAGCTGAAAAGGGAGTCTGGAGGGGTGCGGCACGTCGCGGAGAT
TATGTTCACTAAATGTTCACAAGGCAATGATTAA
 Primer design