SecReT4
Protein ID: 56417287
T4SS name [ID]VirB [496]
Gene symbolvirB10
Locus tagAM1314
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]1158480..1159817 [-]
ProductVirB10 protein
Component typeVirB10
UniProt IDQ5P9C4
KEGG IDama:AM1314
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.5e-51, Aligned region: 238..438
Protein Sequence: 445 a.a.     [Download]
>gi|56417287|ref|YP_154361.1| VirB10 protein [Anaplasma marginale str. St. Maries]
MSLGMSDETKDNNYGDGVEESVNVVGVHKSKKLFVVLVVCAITGMAYYMFFRGSGTTETSEEPQQVIEKQ
DVDKLLKESEAPAQETAPRILTPPPKLPDLPPLVMPTAPELPTLARIAKKKKEEPVVEETKEILPPAAES
FFEPELQRRPMEDDGPPQHIPMPYRPGGGAIPEPVPSFLGYDREKRGTPMIVLGGGGDGGPSEDGGGQGT
DSRFSTWSTLDGTSSPSVKATRVGDPGYVILQGHMIDAVLETAINSDIPGVLRAIVSRDVYAEAGNMVMI
PKGSRLIGSYFFDASGNNTRVTVSWSRVILPHGIDIQINSAGTDELGRNGSAGFIDTKMGNVLTSTILLA
GVSMGTAFVTSKIPALQSEIKDTTEEKGEKKKEEKSSTLPVKIVSDAVKDFSESMKALIKKYVDTSKPTI
YVDQGTVMKVFVNQDIVFPREAVRR
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c1159817-1158480 Anaplasma marginale str. St. Maries chromosome, complete genome
TTGAGTTTAGGGATGTCAGACGAAACCAAGGATAATAACTACGGCGATGGCGTAGAGGAAAGCGTCAATG
TAGTGGGGGTGCACAAAAGCAAGAAGCTTTTTGTAGTCCTGGTAGTGTGCGCTATAACCGGAATGGCCTA
TTACATGTTCTTTCGTGGCAGCGGTACCACAGAAACATCTGAGGAGCCGCAACAGGTTATTGAGAAGCAG
GATGTTGACAAGTTGCTCAAGGAGTCCGAAGCTCCAGCCCAGGAAACTGCGCCGAGAATTTTGACTCCTC
CACCTAAACTGCCTGACCTACCTCCTTTGGTCATGCCTACCGCGCCTGAGCTCCCGACGCTGGCCAGGAT
AGCCAAAAAGAAGAAAGAGGAGCCCGTGGTTGAGGAAACCAAGGAGATTTTACCTCCAGCAGCAGAAAGT
TTCTTTGAACCCGAGTTGCAACGTCGCCCGATGGAGGACGATGGGCCACCGCAGCATATACCTATGCCGT
ACCGGCCAGGTGGGGGAGCTATCCCTGAGCCCGTGCCTTCCTTCTTGGGGTACGATAGAGAAAAACGCGG
TACGCCTATGATCGTCCTGGGAGGGGGTGGTGATGGCGGCCCAAGCGAAGATGGTGGCGGACAAGGCACT
GACAGCCGTTTTAGTACTTGGAGCACACTGGACGGCACTTCGTCCCCTAGCGTTAAGGCAACCAGGGTAG
GCGATCCTGGATATGTGATTCTTCAGGGACACATGATAGATGCAGTTTTAGAGACCGCTATAAACTCAGA
TATTCCCGGAGTGTTGCGGGCAATAGTATCTAGGGATGTATACGCGGAAGCGGGCAATATGGTCATGATA
CCGAAAGGCTCTAGGCTGATAGGTAGCTACTTCTTTGACGCATCCGGCAATAATACGCGGGTGACTGTGA
GTTGGTCTAGGGTCATCCTGCCTCATGGTATAGACATCCAAATTAACTCAGCCGGTACTGATGAGCTGGG
TAGGAACGGTAGCGCAGGGTTTATTGACACCAAAATGGGGAATGTCCTTACGTCCACGATTCTGCTTGCA
GGGGTTTCCATGGGCACTGCTTTTGTGACCTCAAAAATACCTGCTCTGCAGTCTGAAATCAAAGACACTA
CCGAGGAGAAAGGTGAGAAGAAGAAAGAGGAAAAGTCATCTACCCTACCGGTTAAGATCGTTTCTGATGC
CGTAAAGGATTTCTCTGAATCTATGAAGGCTCTGATTAAGAAGTACGTAGATACCAGCAAGCCTACCATT
TATGTTGACCAGGGAACTGTAATGAAGGTATTTGTAAACCAAGACATAGTGTTCCCTAGGGAGGCGGTGC
GTAGGTAG
 Primer design