SecReT4
Protein ID: 56417288
T4SS name [ID]VirB [496]
Gene symbolvirB9
Locus tagAM1315
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]1159825..1160664 [-]
ProductVirB9 protein
Component typeVirB9
UniProt IDQ5P9C3
KEGG IDama:AM1315
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.1e-57, Aligned region: 36..276
Protein Sequence: 279 a.a.     [Download]
>gi|56417288|ref|YP_154362.1| VirB9 protein [Anaplasma marginale str. St. Maries]
MNFYKNLLACSALLTVVFTGGVAQSAVSGGAPVSVDSRIKTFVYSPNEIFTVVFNHGYHSFIEFSKGETI
KVMAMGDSVHWKVKPVDNKLFIMPLEREGKTNMLVETNKGRSYAFDLVSKSAGPDAAGYKEVADELGRVD
SPLLDMAYVVRFYYPDNNREFDLKGAGLADLSAPSLAKNPNSGEVTVRPNATGKNYVYSASSADATIVPV
KTFDDGALTYFQFYDNNKVIPKVFSVGRHGKKVPCRMLLLKGYVIIEGVHKRLYLDYGKSGVEVVNTVL
 
Nucleotide Sequence: 840 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c1160664-1159825 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGAATTTCTATAAAAACTTGCTTGCGTGCTCGGCTCTACTGACCGTTGTTTTTACAGGAGGTGTGGCAC
AGTCTGCCGTAAGCGGTGGTGCACCTGTGTCTGTAGACAGTAGGATCAAAACCTTTGTATACAGCCCGAA
CGAGATATTTACCGTTGTGTTTAACCACGGGTATCACTCGTTTATAGAGTTCTCCAAAGGTGAGACCATA
AAAGTGATGGCTATGGGAGACAGCGTTCACTGGAAGGTAAAGCCCGTAGATAACAAACTGTTCATTATGC
CACTGGAGAGGGAAGGCAAGACAAATATGCTGGTAGAAACCAACAAAGGCAGGAGCTACGCTTTTGATCT
TGTTTCAAAGTCTGCTGGCCCTGATGCCGCGGGGTATAAAGAAGTGGCGGATGAGCTCGGCAGGGTGGAC
TCCCCCCTGTTGGATATGGCCTACGTGGTGCGTTTTTACTACCCGGATAATAACAGGGAGTTCGATCTAA
AAGGGGCCGGACTGGCGGACTTGTCTGCTCCGAGCTTGGCAAAGAACCCCAACAGTGGCGAGGTTACTGT
GCGCCCGAATGCAACTGGCAAGAATTATGTATACTCTGCAAGCAGCGCTGATGCAACAATAGTCCCTGTG
AAAACTTTTGATGATGGGGCCCTTACATATTTTCAGTTCTATGACAATAACAAGGTGATCCCAAAAGTGT
TTTCTGTGGGCAGACATGGCAAAAAAGTGCCATGCAGGATGTTGCTACTTAAGGGCTATGTAATAATCGA
AGGAGTCCACAAGCGGCTGTACCTTGACTACGGCAAGAGTGGCGTCGAAGTAGTGAATACGGTGCTTTGA
 Primer design