SecReT4
Protein ID: 56417289
T4SS name [ID]VirB [496]
Gene symbolvirB8
Locus tagAM1316
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]1160651..1161340 [-]
ProductVirB8 protein
Component typeVirB8
UniProt IDQ5P9C2
KEGG IDama:AM1316
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.2e-53, Aligned region: 20..227
Protein Sequence: 229 a.a.     [Download]
>gi|56417289|ref|YP_154363.1| VirB8 protein [Anaplasma marginale str. St. Maries]
MGMFGFGKKGASAAVSASTDDWYHDRYSSVVVQRNVLLLLVVLSVFCIAVSTFVIFRIGKTRTIEPFVVE
IEKKSGITTLVNPITVKQYSADEVLGNYFIIEYVRARELYDPNNFQYNYYTKVRLLSSQETYSEFRNWIR
PSNPSSPMTLYSDAVSGNLKVRSLQHLSTGNVQIRFSLEFNNHNGSITKRDRIATLAFRYSSLEMNDQDR
QVNPLGFQITYYRADDEFL
 
Nucleotide Sequence: 690 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c1161340-1160651 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGGGTATGTTCGGTTTCGGTAAGAAGGGTGCGAGTGCCGCGGTTTCCGCAAGTACTGATGACTGGTATC
ATGACAGATACAGCTCAGTTGTGGTCCAGCGGAACGTTTTGCTTCTTTTGGTAGTGTTGTCCGTTTTCTG
TATTGCAGTAAGCACTTTTGTAATTTTCAGGATAGGAAAAACAAGGACAATCGAGCCGTTCGTAGTTGAA
ATAGAAAAGAAGTCGGGGATCACCACGTTAGTTAACCCGATCACGGTAAAGCAGTACTCCGCTGATGAGG
TCTTGGGTAATTACTTCATAATTGAGTATGTGCGGGCGAGGGAGCTGTATGATCCCAACAATTTCCAGTA
CAACTATTACACTAAGGTGAGGTTACTCTCCTCCCAGGAGACTTATAGCGAGTTCCGCAACTGGATACGT
CCTAGCAACCCCTCAAGCCCAATGACGCTGTACTCGGACGCAGTATCCGGCAATCTGAAGGTGCGGTCTT
TGCAACATCTTAGCACCGGAAATGTGCAGATTAGGTTTTCCTTGGAGTTTAACAACCACAATGGGTCTAT
CACCAAGAGAGACAGAATTGCCACTCTCGCCTTTAGGTACTCTTCGCTTGAGATGAACGATCAGGATAGG
CAGGTGAACCCTCTGGGATTTCAGATTACTTACTATAGGGCAGACGATGAATTTCTATAA
 Primer design