SecReT4
Protein ID: 56475642
T4SS name [ID]Tfc [731]
Gene symbol-
Locus tagebA400
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]239671..240252 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDQ5P8M9
KEGG IDeba:ebA400
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 193 a.a.     [Download]
>gi|56475642|ref|YP_157231.1| hypothetical protein ebA400 [Aromatoleum aromaticum EbN1]
MTPNATRRAFLVQASAALALLAVPSRSHARAQVRKTPPAYPPIPPAYRHVAESLALPAAILYGVAIQESV
MRWGTVSLPWPWTLNVRAVPRRYGAYETAVADLERILAQGVRNVDCGTMQVNWRYHADKLRTPALALEPW
HNLKVAGFILLECRATTPSWFDAVGAYHSPGDAERAAPYARSVFRHIGRIRDA
 
Nucleotide Sequence: 582 bp     [Download]
>gi|56475432|ref|NC_006513.1|:239671-240252 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGACGCCCAATGCCACCCGCCGCGCCTTCCTGGTGCAGGCCTCCGCAGCGTTGGCGCTGCTCGCCGTAC
CGTCGCGCTCCCACGCCCGGGCGCAGGTGCGCAAGACGCCGCCCGCATATCCGCCAATCCCGCCGGCCTA
TCGCCACGTCGCCGAATCGCTCGCGCTTCCCGCCGCGATCCTGTACGGCGTCGCGATCCAGGAGTCGGTG
ATGCGCTGGGGAACCGTCTCTTTGCCTTGGCCCTGGACCCTCAATGTGCGCGCCGTCCCACGCCGCTACG
GCGCCTATGAGACGGCGGTTGCCGACCTGGAGCGAATCCTGGCGCAGGGCGTGCGCAACGTGGACTGCGG
AACCATGCAGGTCAACTGGCGCTACCACGCCGACAAGCTCCGTACCCCCGCGCTCGCGCTGGAGCCCTGG
CACAACCTGAAGGTGGCCGGTTTCATTCTCCTCGAGTGCCGTGCGACCACCCCGAGCTGGTTCGACGCCG
TCGGCGCCTATCACAGCCCCGGCGACGCCGAACGGGCTGCCCCCTACGCCCGATCAGTGTTTCGCCATAT
CGGCAGGATCCGCGATGCCTGA
 Primer design