SecReT4
Protein ID: 56475644
T4SS name [ID]Tfc [731]
Gene symbol-
Locus tagebA405
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]242574..243341 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ5P8M7
KEGG IDeba:ebA405
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 3.9e-54, Aligned region: 57..252
Protein Sequence: 255 a.a.     [Download]
>gi|56475644|ref|YP_157233.1| hypothetical protein ebA405 [Aromatoleum aromaticum EbN1]
MISAANPATQRPPPRASTAPGAAHSRGPLGALAGLVLGLVFATFSSWVFGTALMIVGDYSFWKERGLDRA
RAAVDEDLGYIRGFPRSLMVEDTVGFAAGLAERMTRPYTWLGAPAFIARAQAVEPDSATNRHARIAVQAI
KEGGRWMEISLHVARDTAIRLAVAFYALPAFVMAVCIGLIDGLVRRDLRKWSGGRESSYVYHHAKRFTWW
FLTAGFTAYLAWPFGGFNPAYLVLVFALLVAASVSTTASTFKKYL
 
Nucleotide Sequence: 768 bp     [Download]
>gi|56475432|ref|NC_006513.1|:242574-243341 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGATCTCCGCAGCAAACCCGGCCACTCAGCGTCCGCCGCCCCGGGCCTCTACCGCGCCCGGCGCCGCCC
ACTCGCGCGGCCCGCTCGGAGCGCTTGCGGGCCTCGTGCTCGGACTGGTGTTTGCGACTTTCAGCTCCTG
GGTCTTCGGGACGGCGCTGATGATCGTCGGGGACTACAGCTTCTGGAAGGAGCGCGGCCTCGATCGCGCC
CGGGCCGCGGTCGACGAGGATCTCGGTTATATCCGCGGCTTCCCGCGTTCGCTGATGGTCGAGGACACGG
TCGGCTTCGCCGCCGGCCTTGCCGAGCGCATGACGCGCCCCTACACGTGGCTGGGTGCTCCTGCCTTCAT
CGCACGCGCCCAGGCCGTGGAGCCGGACAGCGCGACCAATCGCCACGCCCGCATCGCGGTACAGGCGATC
AAGGAAGGCGGGCGCTGGATGGAGATCTCACTCCACGTGGCGCGGGACACGGCGATACGCCTTGCCGTCG
CCTTTTATGCCTTGCCCGCATTCGTCATGGCGGTCTGCATCGGCCTCATCGACGGCCTGGTGCGGCGTGA
CCTGCGCAAGTGGTCGGGGGGCAGGGAATCCTCCTATGTCTACCACCACGCGAAACGCTTCACCTGGTGG
TTCCTGACCGCCGGTTTCACCGCCTATCTCGCCTGGCCCTTCGGGGGCTTCAACCCGGCCTACCTTGTCC
TCGTTTTCGCGCTCCTGGTCGCAGCGTCGGTCTCGACCACGGCCTCCACCTTCAAGAAGTATCTCTGA
 Primer design