SecReT4
Protein ID: 56475654
T4SS name [ID]Tfc [731]
Gene symbol-
Locus tagebA419
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]252060..253376 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDQ5P8L7
KEGG IDeba:ebA419
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 438 a.a.     [Download]
>gi|56475654|ref|YP_157243.1| hypothetical protein ebA419 [Aromatoleum aromaticum EbN1]
MRATSLALLLAFGAATTSAEAVEIPSSGSSLYYRLGGGDPASRAPNPSGVPYKLGLSGVARMHYACGAYD
FEVSFQNLMNQFAHLGTQVTHAVQAGIAALPLYLFQRASPGLYELFQTYAKKAEVAIQIATKTCEEMEAQ
VKAGEDPYEDFIRVARGEAWKKEAAGGKDVVQAKENVGAKNGNDGVTWVGGVKAGGVGQKAIKIVYDTVF
GGFNVTMGQPPTASAPAYSAVKLTETFSTPDVAATYATDVLGDLEIFTCTDDSCPPHQSKMGLGLVQKFE
LEIPDAQSEVEILLATQVPRGNDLKAASAPGLLITREVIDAIRELPSIERHIAKERLAQDVALARTVDKA
LTIRNLLLTGRMMPEVYKTANQQLEAKLAELNRHIDDVLYESNVRKRVISETAGTLLDSYHALRAASAAN
SVQQPVDKRPLIDGRVKK
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|56475432|ref|NC_006513.1|:252060-253376 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGCGCGCCACGTCCCTCGCCCTACTCCTCGCTTTCGGCGCGGCGACCACGTCCGCGGAAGCCGTGGAGA
TCCCGAGCTCGGGATCCAGCCTCTATTACCGTCTCGGCGGCGGCGACCCCGCGTCACGGGCGCCGAACCC
CTCCGGGGTGCCGTACAAGCTGGGGCTCTCCGGCGTGGCAAGGATGCACTACGCCTGCGGTGCGTACGAC
TTCGAGGTGTCGTTCCAGAACCTCATGAACCAGTTCGCCCACCTCGGCACCCAGGTGACCCATGCGGTCC
AGGCCGGCATCGCCGCCCTGCCGCTGTATCTGTTCCAGCGCGCCTCACCCGGGCTGTACGAGCTGTTCCA
GACCTACGCAAAGAAGGCCGAGGTGGCCATCCAGATCGCCACCAAGACCTGCGAGGAAATGGAGGCCCAG
GTCAAGGCCGGAGAGGATCCCTATGAAGATTTCATCCGCGTGGCGCGCGGCGAGGCTTGGAAGAAAGAGG
CCGCCGGCGGGAAGGATGTGGTGCAGGCGAAGGAGAACGTGGGGGCAAAGAACGGAAACGATGGTGTGAC
CTGGGTGGGTGGCGTGAAAGCGGGCGGCGTTGGTCAGAAGGCGATCAAGATCGTCTACGACACAGTTTTC
GGCGGGTTCAACGTCACCATGGGCCAACCGCCGACTGCATCGGCCCCGGCCTATTCAGCAGTAAAGCTGA
CTGAAACTTTCTCAACCCCGGACGTGGCGGCCACCTATGCAACCGATGTGCTCGGCGATCTTGAGATCTT
TACCTGTACCGATGACTCGTGCCCTCCGCATCAGTCGAAGATGGGTCTCGGCCTCGTTCAGAAGTTCGAA
CTCGAGATTCCGGATGCTCAATCGGAAGTTGAGATCTTGCTCGCCACGCAGGTGCCACGAGGAAACGACC
TGAAGGCCGCGTCGGCCCCCGGTCTTCTAATCACCCGCGAGGTGATCGACGCGATTCGAGAATTGCCTTC
CATCGAACGCCACATTGCTAAGGAACGCTTGGCCCAAGACGTCGCCTTGGCACGAACGGTCGACAAGGCC
TTGACGATCCGCAATTTACTTCTTACCGGCCGCATGATGCCCGAGGTCTATAAGACCGCGAACCAGCAGC
TCGAAGCGAAGCTCGCCGAACTGAACCGCCATATCGACGACGTGCTGTACGAGTCCAACGTCCGCAAGCG
GGTCATCTCGGAGACCGCCGGAACGCTGCTCGACAGCTACCACGCGTTGCGCGCGGCATCGGCCGCAAAC
TCGGTTCAGCAGCCCGTCGACAAGCGTCCCCTCATCGACGGCCGGGTGAAGAAGTGA
 Primer design