SecReT4
Protein ID: 56476775
T4SS name [ID]Tfc [732]
Gene symbol-
Locus tagebA2397
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]1431119..1432522 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDQ5P5E9
KEGG IDeba:ebA2397
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 467 a.a.     [Download]
>gi|56476775|ref|YP_158364.1| hypothetical protein ebA2397 [Aromatoleum aromaticum EbN1]
MKASLSRFARRTKPYALAVALACAVTAAASVAWAQTRIDRNGASVSGSVIGDDVLYSIGGGRAVSMGGAG
NMQSIGVGIGWNSNLICGDMSITTTLQNQLNGITNGFQAIMSSVIQSATSAVASLPALIIQRADPGLYNL
LTNGVLQARLDFDRSKMTCRAIANRLADMAGGQAGWDQLAEGMALRDAVSSADAVSAIEQAESNKGNSGV
PWVGGSNAGGSGQGSIKVVGDVTRAGYNLLNGRSATDTSSIPRTSCGNRLTCQTWSSPSAAAAWATRVLG
EREQRTCESCTKTQTTPGVGLTPVIQEEYETKLQALQELVTGAKPTTVANLEAAGSNSLPITRGVIEALR
DEPDQDLLGKRLASEAALSSALEKALLLQRTLLTGKKEPNVAANELAVKAVDQENSALEQEINNLKTELE
LRRTLAGNSAMAIVQRHGTRAGGSRGIFEGDTTRDRLKEVQKPRGTP
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|56475432|ref|NC_006513.1|:c1432522-1431119 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGAAAGCGTCCCTTTCCCGCTTCGCTCGGCGGACCAAGCCCTATGCCCTTGCCGTCGCGCTCGCCTGCG
CCGTAACGGCAGCGGCAAGCGTCGCCTGGGCACAGACCCGCATCGACCGCAACGGCGCCAGCGTGAGCGG
CAGCGTCATCGGCGACGACGTGCTATACAGCATCGGCGGCGGCCGGGCCGTGTCCATGGGTGGCGCCGGG
AACATGCAGAGCATCGGCGTCGGGATCGGCTGGAATAGCAACCTGATCTGCGGCGACATGAGCATCACGA
CGACGCTGCAGAACCAGCTCAACGGCATCACCAACGGCTTCCAGGCAATCATGAGCTCGGTGATCCAGAG
CGCCACCAGCGCCGTGGCATCGCTGCCGGCGCTGATCATCCAGCGCGCCGACCCCGGCCTCTACAACCTG
CTCACCAACGGCGTTCTGCAGGCCCGCCTGGACTTCGATCGCTCGAAGATGACCTGCCGGGCCATCGCCA
ACCGGCTCGCCGACATGGCCGGCGGGCAGGCCGGCTGGGACCAGCTCGCCGAGGGTATGGCGTTGCGGGA
TGCGGTCAGCAGCGCTGACGCCGTCTCGGCGATCGAGCAGGCTGAGTCGAACAAGGGCAACAGCGGTGTG
CCCTGGGTTGGCGGCAGCAACGCTGGCGGCTCGGGCCAGGGGTCGATCAAGGTGGTGGGCGACGTGACGC
GCGCGGGCTACAACCTGCTCAACGGACGCAGCGCGACGGACACTTCGTCGATCCCGCGCACTTCCTGCGG
CAACCGGCTGACCTGCCAGACCTGGTCCTCGCCTTCTGCGGCTGCGGCCTGGGCGACCCGCGTGCTTGGC
GAGCGTGAGCAGCGCACCTGCGAAAGTTGCACCAAGACCCAGACCACGCCCGGTGTCGGACTCACGCCGG
TGATCCAGGAGGAGTACGAGACCAAGCTGCAGGCGCTGCAGGAACTGGTGACGGGGGCGAAGCCGACGAC
GGTGGCAAACCTAGAAGCGGCCGGAAGCAATTCGCTGCCGATCACCCGCGGTGTGATCGAGGCCCTTCGC
GACGAGCCCGACCAGGATCTGCTGGGCAAGCGCCTGGCCTCCGAGGCAGCGCTGTCCAGTGCGCTGGAGA
AGGCATTGCTGTTGCAGCGCACCTTGCTCACCGGCAAGAAGGAGCCGAACGTTGCAGCCAACGAACTGGC
CGTGAAGGCGGTCGACCAGGAGAACAGCGCGCTGGAGCAGGAAATCAACAACCTCAAGACCGAACTCGAA
CTGCGGCGCACGCTGGCGGGCAATTCCGCGATGGCGATCGTCCAGCGCCACGGTACTCGCGCCGGTGGAT
CGCGCGGCATCTTCGAGGGTGACACCACGCGCGACCGCCTCAAGGAAGTCCAGAAGCCCCGGGGCACGCC
ATGA
 Primer design