SecReT4
Protein ID: 56476785
T4SS name [ID]Tfc [732]
Gene symbol-
Locus tagebB69
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]1441938..1442363 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDQ5P5D9
KEGG IDeba:ebB69
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 7e-49, Aligned region: 11..132
Protein Sequence: 141 a.a.     [Download]
>gi|56476785|ref|YP_158374.1| hypothetical protein ebB69 [Aromatoleum aromaticum EbN1]
MIGPSESPRDGLVTFLPHRLNRHPVVVRGLTADELWVCAGLSAAAGFVAGVPLAWLTHSIAMVPTLVVVG
IGVGVFAGGGFLRRQKRGRPDTWLYRQLQWRLALRFPSLGAHVGGGQLITRSGWWTTRRQRTSTFIRRGG
A
 
Nucleotide Sequence: 426 bp     [Download]
>gi|56475432|ref|NC_006513.1|:c1442363-1441938 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGATTGGCCCCTCGGAGAGTCCGCGCGACGGGCTCGTGACCTTTCTGCCGCATCGGCTGAACCGGCACC
CCGTGGTCGTGCGTGGGCTCACTGCCGACGAGTTGTGGGTCTGCGCCGGCCTGTCGGCCGCGGCGGGGTT
CGTGGCGGGCGTGCCGTTGGCCTGGCTGACCCACAGCATCGCGATGGTACCGACATTGGTCGTCGTAGGT
ATCGGGGTCGGCGTTTTCGCGGGCGGCGGCTTCCTGCGCCGGCAGAAGCGCGGCCGGCCCGACACCTGGC
TCTACCGCCAGCTCCAGTGGCGGCTCGCGCTGCGCTTTCCGTCGCTGGGGGCTCACGTGGGGGGCGGCCA
GCTTATCACCCGCTCGGGCTGGTGGACCACGCGGCGCCAGCGGACTTCCACGTTCATCCGGCGAGGTGGT
GCATGA
 Primer design