SecReT4
Protein ID: 56476787
T4SS name [ID]Tfc [732]
Gene symbol-
Locus tagebA2412
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]1443003..1443371 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDQ5P5D7
KEGG IDeba:ebA2412
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2e-31, Aligned region: 32..111
Protein Sequence: 122 a.a.     [Download]
>gi|56476787|ref|YP_158376.1| hypothetical protein ebA2412 [Aromatoleum aromaticum EbN1]
MGHTNRHASTLHHLMAVLPLALVVSFSVVPPAHAADDTPEREQLAALARQLDLLDRLAEHATNTAPQYRS
RYHFDYARLRTDLKRVRAGVQDYLVPRRAQPRDSVPLTGDYVRRDDREESTP
 
Nucleotide Sequence: 369 bp     [Download]
>gi|56475432|ref|NC_006513.1|:c1443371-1443003 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGGGACATACCAACCGCCACGCATCCACATTGCATCACTTGATGGCCGTGCTGCCATTGGCATTGGTCG
TGTCGTTCTCGGTTGTGCCTCCTGCCCATGCCGCCGACGACACGCCGGAGCGTGAGCAACTCGCCGCACT
TGCACGTCAGCTCGACCTGCTCGATCGCCTCGCCGAGCACGCCACCAACACTGCGCCGCAATACCGCAGC
CGTTACCACTTCGACTATGCCCGATTGCGGACGGACCTCAAGCGCGTCCGCGCCGGCGTGCAGGACTACC
TCGTCCCACGGCGCGCCCAACCACGCGATTCGGTCCCGCTGACCGGCGATTACGTGCGCCGCGACGACCG
GGAGGAGTCCACGCCATGA
 Primer design