SecReT4
Protein ID: 56476794
T4SS name [ID]Tfc [732]
Gene symbol-
Locus tagebA2420
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]1456193..1456942 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDQ5P5D0
KEGG IDeba:ebA2420
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.9e-71, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|56476794|ref|YP_158383.1| hypothetical protein ebA2420 [Aromatoleum aromaticum EbN1]
MSDPAVAAQRQQQRQQGLIAGLVTLPFRFFGVLCGALLLCILIEFVGMHFFWPDQGWRHAQGMLHYELDQ
LSTYFTRSALVQEPGRTAHRLVEQGYDWLFVKSGLLDWIRDASVQASAGSHRPTKDFRYYIGLVYVNVES
YLIAAAYTTLVFLVRLLVLCLTLPLFLVAAFVGLVDGLVRRDIRRFGAGRESGFIYHRARASLIPLAVLP
WVTYLALPVSVNPLLILLPSAALLGVAVCIAAATFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|56475432|ref|NC_006513.1|:c1456942-1456193 Aromatoleum aromaticum EbN1 chromosome, complete genome
GTGAGCGATCCGGCCGTCGCGGCCCAGCGCCAGCAGCAACGACAGCAGGGGCTGATCGCCGGCCTGGTCA
CGCTGCCGTTCCGCTTCTTCGGCGTGCTGTGCGGCGCGCTGCTGCTGTGCATCCTGATCGAATTCGTCGG
CATGCACTTCTTCTGGCCCGATCAGGGCTGGCGCCACGCGCAGGGCATGCTGCACTACGAGCTGGATCAG
CTCTCCACGTATTTCACGCGCAGCGCGCTGGTGCAGGAGCCGGGGCGCACCGCGCACCGGCTTGTCGAAC
AGGGCTACGACTGGCTGTTCGTGAAAAGCGGTCTGCTGGACTGGATACGCGACGCCTCGGTGCAGGCCAG
CGCCGGCAGCCATCGCCCGACCAAGGATTTCCGTTACTACATCGGCTTGGTCTACGTGAACGTGGAGAGC
TACCTGATCGCGGCGGCCTATACGACGCTGGTCTTCCTCGTGCGGCTGCTGGTGCTGTGCCTGACCCTGC
CACTGTTCCTGGTGGCCGCCTTCGTCGGGCTGGTGGACGGCCTGGTGCGCCGGGACATCCGCCGCTTCGG
CGCGGGACGCGAGTCGGGGTTCATCTATCACCGCGCCAGGGCCAGCCTGATCCCGCTGGCCGTGCTGCCG
TGGGTGACTTACCTAGCACTGCCGGTCAGCGTGAACCCGCTGCTGATCCTGCTGCCCAGCGCCGCATTGC
TCGGCGTGGCGGTGTGCATTGCGGCGGCGACGTTCAAGAAGTACCTGTAG
 Primer design