SecReT4
Protein ID: 56476797
T4SS name [ID]Tfc [732]
Gene symbol-
Locus tagebA2424
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]1459654..1460235 [-]
Producthypothetical protein
Component typeTfc4
UniProt IDQ5P5C7
KEGG IDeba:ebA2424
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 193 a.a.     [Download]
>gi|56476797|ref|YP_158386.1| hypothetical protein ebA2424 [Aromatoleum aromaticum EbN1]
MATAALTRCHAMLVLLVSWLVGAAQAQEVPPPAYQVAAQRAGIPSTVLYAVALQESGTRFNGRLVPWPWM
LNVAGASRRFASRAEACAGLRKALASTPENRIDAGLGQVNLGYHTQRYDHPCELLDPYRNLAIAAEILRE
QHMPGEDWLIAIGRYHRPAGGAPAVRYRQSVHLHLARVLGPDASVISTRTTTP
 
Nucleotide Sequence: 582 bp     [Download]
>gi|56475432|ref|NC_006513.1|:c1460235-1459654 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGGCAACGGCAGCCCTGACCCGGTGCCACGCCATGCTCGTGCTGCTGGTGAGCTGGCTGGTCGGCGCCG
CGCAGGCGCAGGAAGTCCCGCCGCCGGCCTATCAGGTCGCAGCGCAGCGCGCCGGTATCCCCTCGACCGT
GCTCTATGCCGTCGCCTTGCAGGAAAGCGGCACCCGCTTCAACGGCCGCCTCGTGCCCTGGCCCTGGATG
CTCAACGTGGCCGGTGCCTCGCGCCGCTTCGCCTCCCGCGCCGAGGCCTGCGCCGGCCTGCGCAAAGCGC
TCGCCAGCACCCCCGAGAACCGCATCGATGCTGGCCTGGGACAAGTGAACCTCGGCTACCACACGCAGCG
CTACGACCACCCCTGCGAGCTGCTCGATCCGTACCGCAATCTCGCCATCGCCGCGGAAATTCTGCGGGAG
CAGCACATGCCTGGCGAGGACTGGCTGATCGCCATCGGCCGCTATCACCGACCGGCTGGCGGCGCGCCGG
CCGTCCGTTACCGCCAAAGCGTCCATCTGCACCTCGCCCGCGTACTGGGGCCCGACGCGTCCGTTATCTC
CACCCGGACCACCACGCCATGA
 Primer design