SecReT4
Protein ID: 56479208
T4SS name [ID]Tra_F [554]
Gene symbol-
Locus tagebA6594
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]3914540..3915076 [+]
Producttransglycosylase
Component typeOrf169_F
UniProt IDQ5NYG8
KEGG IDeba:ebA6594
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 178 a.a.     [Download]
>gi|56479208|ref|YP_160797.1| transglycosylase [Aromatoleum aromaticum EbN1]
MGRLPQFAALAAFAFLALAPTGAQACWEEAAKRYGISADLLYAIARVESNLNPLAVNRSHVRRTGSYDIG
LMQINSGHLRTLSRHGIREADLFEPCTNIHVGAWLLADSFSRRGATWDAVGAYNAACSQLRGQDCAEARA
KYAWRVYRQLPRQRGPRSSSQTVSTVATPGLMSARVSP
 
Nucleotide Sequence: 537 bp     [Download]
>gi|56475432|ref|NC_006513.1|:3914540-3915076 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGGGTCGACTGCCGCAATTTGCTGCCCTGGCTGCCTTCGCCTTCCTGGCGCTCGCGCCCACCGGGGCGC
AAGCCTGCTGGGAGGAGGCTGCCAAGCGCTACGGCATCTCGGCCGACCTGCTCTATGCCATTGCCCGGGT
CGAGTCGAACCTGAATCCCCTGGCGGTCAATCGCTCACACGTCCGGCGCACCGGGTCCTACGACATCGGG
CTCATGCAGATCAACAGCGGACACCTGCGGACCCTATCCCGTCACGGTATCCGGGAAGCCGATCTCTTCG
AGCCCTGCACCAACATCCATGTCGGTGCCTGGCTGCTCGCGGACAGTTTTTCGCGGCGAGGCGCGACGTG
GGATGCCGTCGGCGCCTACAACGCGGCCTGCTCGCAACTCAGGGGCCAGGACTGCGCCGAGGCCCGCGCC
AAATACGCCTGGCGGGTGTACCGCCAGTTGCCTCGGCAACGCGGCCCACGCTCGAGTTCGCAGACGGTAT
CGACGGTGGCGACCCCCGGCCTAATGTCGGCGAGGGTCTCGCCATGA
 Primer design