SecReT4
Protein ID: 56479211
T4SS name [ID]Tra_F [554]
Gene symboltraE
Locus tagebA6600
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]3916579..3917145 [+]
Productplasmid-like conjugative transfer protein TraE
Component typeTraE_F
UniProt IDQ5NYG5
KEGG IDeba:ebA6600
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.2e-33, Aligned region: 1..184
Protein Sequence: 188 a.a.     [Download]
>gi|56479211|ref|YP_160800.1| plasmid-like conjugative transfer protein TraE [Aromatoleum aromaticum EbN1]
MDFERLNGDIKEMRRRNRGLGLAVGVLAAGQILALVVILNLLGTVRTVVVPPALNQTFWVTRDQASHEYL
EQMGSFIAWLILDVTPASIDWKKGVLLGYVEPEQYGPLKTRQEVEAERLKRINAATVFAPQQLVPSEAAQ
SVVIRGRLRTLVNGFETANELKAYLIEFSYAGARMHLKAFKEVPYASK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|56475432|ref|NC_006513.1|:3916579-3917145 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGGACTTCGAACGGCTCAACGGCGACATCAAGGAGATGCGGCGCCGCAATCGCGGGCTCGGCCTGGCGG
TCGGCGTGCTGGCTGCCGGCCAGATCCTTGCCCTGGTGGTCATCCTCAATCTGCTGGGAACGGTGCGCAC
GGTCGTCGTGCCGCCCGCCCTCAACCAGACTTTCTGGGTCACCCGCGACCAGGCCAGCCACGAATATCTA
GAGCAGATGGGCAGCTTCATCGCCTGGCTGATCCTCGACGTAACGCCGGCGTCGATCGACTGGAAGAAGG
GCGTCCTCTTGGGCTACGTCGAGCCCGAGCAGTACGGCCCGCTCAAGACGCGGCAGGAAGTGGAGGCCGA
GCGCCTGAAGCGCATCAACGCGGCCACCGTGTTCGCGCCCCAGCAACTCGTCCCCAGCGAGGCGGCGCAG
AGCGTCGTCATTCGCGGGCGCCTGCGCACCCTGGTCAACGGCTTCGAGACGGCCAACGAACTCAAGGCCT
ACCTGATCGAGTTCAGCTATGCCGGCGCGCGCATGCACCTGAAGGCCTTCAAGGAGGTGCCCTATGCGAG
CAAATAG
 Primer design