SecReT4
Protein ID: 56479212
T4SS name [ID]Tra_F [554]
Gene symbol-
Locus tagebA6601
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]3917132..3918004 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDQ5NYG4
KEGG IDeba:ebA6601
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 1.8e-26, Aligned region: 29..283
Protein Sequence: 290 a.a.     [Download]
>gi|56479212|ref|YP_160801.1| hypothetical protein ebA6601 [Aromatoleum aromaticum EbN1]
MRANRSASHPATTPLPVQRIGQALSAIATVAAVILAAPVHALQLVEASDGVSVEAILSIKEPTRIRIENA
PITDVFGNILSSNCGPSPALPTNPGTTAPGAGLPTINPGGEIVLECDRDKGEVYIRPVGDSAKPVNLFVS
SADATYTLLLRRADTPADTIVIRDKTPKAFRATGAAQAAAGPSPNPIRAMKALLVAMTTDRVPADVQVEE
AHRTIQLWTEVRFSLVRQYEGRGLIGEKFLLQNVGTEPMVLAEQEFDRDGGEVAGIAIEHHNLRPGESTS
VYVIRRGGGR
 
Nucleotide Sequence: 873 bp     [Download]
>gi|56475432|ref|NC_006513.1|:3917132-3918004 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGCGAGCAAATAGATCAGCAAGTCATCCAGCCACGACACCGCTACCAGTGCAGCGCATCGGACAGGCAT
TGTCGGCGATCGCTACGGTCGCCGCGGTGATCCTGGCAGCGCCCGTCCATGCCCTGCAGCTCGTCGAGGC
CAGCGACGGCGTTTCCGTCGAAGCCATCCTCTCGATCAAGGAGCCGACGCGCATCCGCATCGAGAACGCG
CCGATCACCGACGTATTCGGCAACATTCTGTCGAGCAACTGCGGCCCGTCTCCGGCGCTGCCCACGAACC
CCGGCACCACGGCGCCCGGGGCCGGCCTGCCGACGATCAATCCGGGCGGCGAGATCGTGCTGGAGTGCGA
CCGCGACAAGGGCGAGGTCTATATCCGCCCGGTGGGCGACTCGGCAAAGCCGGTCAACCTGTTCGTCTCG
TCGGCCGACGCCACCTACACGCTGCTGTTGCGCCGTGCCGACACCCCAGCCGACACCATCGTCATCCGCG
ACAAGACGCCCAAGGCGTTCAGGGCGACGGGGGCGGCTCAGGCGGCGGCCGGGCCGTCGCCGAATCCCAT
CCGGGCGATGAAGGCCCTGCTGGTGGCGATGACCACGGACCGTGTGCCGGCGGACGTCCAGGTGGAGGAA
GCCCACCGCACGATCCAGCTTTGGACGGAAGTGCGCTTCTCGTTGGTACGCCAGTACGAGGGGCGCGGTC
TCATCGGGGAGAAGTTCCTGCTGCAGAACGTCGGCACCGAACCCATGGTGTTGGCGGAGCAGGAGTTCGA
CCGAGACGGCGGTGAGGTCGCCGGAATCGCCATCGAGCACCACAACCTGCGCCCCGGCGAGAGCACCAGC
GTTTACGTGATCCGGCGCGGAGGTGGGCGATGA
 Primer design