SecReT4
Protein ID: 56479213
T4SS name [ID]Tra_F [554]
Gene symboltraB
Locus tagebA6607
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]3918001..3919362 [+]
Productplasmid-like sex pilus assembly protein TraB
Component typeTraB_F
UniProt IDQ5NYG3
KEGG IDeba:ebA6607
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.4e-44, Aligned region: 227..421
Protein Sequence: 453 a.a.     [Download]
>gi|56479213|ref|YP_160802.1| plasmid-like sex pilus assembly protein TraB [Aromatoleum aromaticum EbN1]
MNAPRQPAHALRALAERLSPKQRQYAMLGTIVAGGVGILWLIFAFTGSSARNGEARTAAGQPGTVTNIGV
MPPGGQVNPVDQWVGTAGRKLAQYEAEREEQARLNKDRQAFEAKTLQRFAELEQRLTSAQQAAATPAPPK
PADPPTSMPPAPPPPKAVSAGAMPPGAPGNLPPPAIAPAIPTITRISLNDRSGVSTGSRATSNTETALAS
GAGALTPPTLSTFLPVSFTRGTLLGGLDAPTGGQSQANPHPVLIRLSDNSVLPNRFRGEYRECFVIAAGY
GDISSERAYLRTESLSCVRADGATLEVKIQGSVYGEDGKVGMRGRLVTKQGQMLANALLAGVVSGIGQGL
ATSSTEYSTSALGTVASATGAEAYRAGLGTGVGKALDRLAQYYIKLAENTFPVIEVDAGREIDVVITKGV
RIDVPMAANAAPASRFPASPETRYLETSDDGNY
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|56475432|ref|NC_006513.1|:3918001-3919362 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGAACGCGCCGCGCCAACCCGCCCACGCCCTGCGCGCCCTGGCGGAACGCCTGTCGCCCAAGCAGCGCC
AGTACGCGATGCTGGGGACCATCGTCGCCGGCGGCGTCGGCATCCTCTGGCTGATCTTCGCCTTCACCGG
CTCCAGTGCCAGGAACGGCGAGGCCCGCACTGCCGCTGGGCAACCCGGCACCGTCACCAACATAGGCGTC
ATGCCGCCCGGCGGCCAGGTCAACCCGGTGGACCAATGGGTCGGCACGGCAGGACGCAAGCTCGCCCAGT
ACGAAGCCGAGCGCGAGGAGCAAGCACGGCTCAACAAGGACCGCCAGGCCTTCGAGGCGAAGACCCTGCA
GCGCTTCGCGGAGCTGGAACAACGGCTCACCTCGGCCCAACAGGCCGCCGCCACACCGGCTCCGCCGAAG
CCGGCAGATCCGCCGACATCCATGCCGCCGGCGCCACCGCCGCCCAAGGCAGTATCGGCGGGCGCGATGC
CTCCCGGCGCCCCGGGGAATCTGCCCCCACCCGCGATCGCGCCGGCCATACCCACGATCACCCGCATCTC
CCTGAACGATCGATCCGGGGTCAGCACCGGTTCCCGAGCGACGTCGAACACAGAAACGGCCTTGGCGTCG
GGCGCCGGGGCGCTGACCCCACCTACCCTCTCCACCTTTCTGCCGGTGAGTTTCACGCGCGGCACCTTGT
TGGGCGGGCTCGATGCGCCCACCGGCGGCCAGTCCCAGGCCAACCCCCACCCGGTGCTGATCCGCCTCTC
GGACAACAGCGTGCTACCGAATCGCTTCCGCGGCGAATACCGCGAGTGCTTCGTGATCGCGGCCGGCTAC
GGCGACATCAGCTCCGAGCGCGCCTATCTGCGCACCGAGAGCCTGTCCTGCGTGCGGGCCGACGGCGCCA
CGCTGGAAGTGAAGATCCAGGGCAGCGTCTACGGCGAGGACGGCAAGGTCGGCATGCGCGGGCGCCTGGT
CACCAAGCAGGGGCAGATGCTCGCCAATGCGCTGCTGGCCGGCGTGGTGAGCGGGATCGGCCAGGGCCTG
GCGACCTCGTCGACTGAATACAGCACCTCGGCGCTGGGCACTGTCGCCAGCGCCACCGGTGCCGAAGCCT
ACCGTGCCGGCCTCGGCACCGGGGTCGGCAAGGCGCTGGACCGCCTGGCCCAGTACTACATCAAGCTCGC
CGAGAACACCTTCCCGGTCATCGAGGTCGATGCCGGCCGCGAGATCGACGTGGTGATCACCAAGGGCGTG
CGCATCGACGTGCCGATGGCCGCGAATGCCGCCCCGGCATCGCGCTTCCCCGCCTCTCCCGAAACCCGCT
ACCTGGAGACCTCCGACGATGGCAACTACTGA
 Primer design