SecReT4
Protein ID: 56479215
T4SS name [ID]Tra_F [554]
Gene symboltraV
Locus tagebA6611
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]3920149..3920736 [+]
Producthypothetical protein
Component typeTraV_F
UniProt IDQ5NYG1
KEGG IDeba:ebA6611
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 4.9e-28, Aligned region: 30..138
Protein Sequence: 195 a.a.     [Download]
>gi|56479215|ref|YP_160804.1| hypothetical protein ebA6611 [Aromatoleum aromaticum EbN1]
MKTLILRIATACLLLPLGACMNMSGLGGDSKYACKAPEGVACDSVSGTYANALHHNLPSQRARRSPAARQ
EESDERAPQATTRAASPATAGDAGTSVTPSPLRSQARVLRLWIKPWEDADGDLYDQGYVYVQVDNGQWLI
DHVQRQIRDAYAPLKPPPKSAPDTATESNPGGNSPAAPSLLQRPTVTGPGASRAQ
 
Nucleotide Sequence: 588 bp     [Download]
>gi|56475432|ref|NC_006513.1|:3920149-3920736 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGAAGACCCTCATCCTGCGCATCGCCACGGCCTGCCTGCTCCTCCCTCTGGGTGCCTGCATGAACATGT
CGGGACTGGGCGGCGACTCAAAGTACGCCTGCAAGGCGCCCGAAGGGGTCGCCTGCGATTCGGTGTCTGG
CACCTATGCCAATGCCCTTCATCATAACCTGCCCAGCCAGCGGGCGCGGCGCTCCCCCGCCGCCCGCCAA
GAGGAATCCGACGAGCGGGCTCCCCAAGCGACGACGCGCGCTGCATCTCCTGCAACGGCCGGCGATGCCG
GTACCAGCGTGACGCCCAGCCCCTTGCGCTCGCAGGCCCGCGTCCTGCGCCTGTGGATCAAGCCTTGGGA
AGACGCGGACGGTGACCTGTACGACCAGGGCTACGTGTATGTGCAGGTGGACAACGGCCAATGGCTGATC
GACCACGTGCAGCGCCAGATCCGCGACGCCTATGCGCCACTGAAGCCACCGCCCAAATCCGCTCCGGATA
CCGCCACCGAATCGAACCCCGGAGGCAACTCGCCGGCCGCGCCGAGCTTGCTGCAGCGGCCAACCGTCAC
CGGACCCGGCGCCAGCCGCGCACAGTGA
 Primer design