SecReT4
Protein ID: 56479216
T4SS name [ID]Tra_F [554]
Gene symboltraC
Locus tagebA6614
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]3920744..3923302 [+]
Producthypothetical protein
Component typeTraC_F
UniProt IDQ5NYG0
KEGG IDeba:ebA6614
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 8.9e-70, Aligned region: 29..279
AAA_10 [PF12846], Evalue: 7.8e-46, Aligned region: 477..767
Protein Sequence: 852 a.a.     [Download]
>gi|56479216|ref|YP_160805.1| hypothetical protein ebA6614 [Aromatoleum aromaticum EbN1]
MSTPYRDTPTPRRPEAPRFPFGRPVETSAEQFANWLPYSAYLSAEKIFVNRDSMGFLLELMPQSGADERM
AEVLVSLYANCPTGTGIQFHLFASPQVREPLRRYANLRVEDATQAEQAKAWGRPARNGNLFRKLARQRVG
HLLQGAQKSLTAGFHYTIRDFRLMLSVAFPGDAEDLNRRDELMALRDSMSSTLRSASLPNRVCDAADLIN
WCALFTNPDRISQTDAPDLHYDDGRELRDQIVDFDTIQDPHPGGLTLWKEASSDVLEARFYSIKSFPERF
ALWQMGSLIGDLMQPALQYSAPFLLTLGVHVLDPNVTKSVVTANHVRATQNAKSKMADVMPDVKKKLDDW
TAAADAIDTGGSLVSLYHQLALFTAPDKAVAAHEAANAIWRGRGFQLNADAYMHRQALLASLPMTLTEKF
HRDLVKMRRVTRKTMANAIHMAPLIAEWRGTRTPALVFGGRRGQLMTLDIFDNDLGNYNFAIIGAPGSGK
SVLMNEMAWSYRAIGAKVWMLDLGRSFEKLCRKAQGTYIEFRPDVDICLDPFTHIVDINEDIDMLVPGIA
KMCSMQHALEEVQYKAISAMVLKLWREYGNGLRITGLRDAFKGGTIEELGVVNDQRIKDLAIMLNPYARG
GQYERFFEGRNNVDFSNDFIVIENEELKRRPDLHAVVNILLLHRITGEMYLTRNRRKVLFVDELKQQLGD
IGADDPVKAAVIEEAARRARKYGGALGTATQSADDFYGSAQMEAAFNCSDWVFLLRQKPESIEMLDRKGR
LTMDEPKKRLLNSLRTEAGVFSELYISSPVGEGVARAILDPATHLLFSNKLEDNAPIDELRARGLSIDEA
ISELLRRRGHAV
 
Nucleotide Sequence: 2559 bp     [Download]
>gi|56475432|ref|NC_006513.1|:3920744-3923302 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGAGCACCCCGTATCGCGACACCCCTACACCCCGCCGCCCCGAGGCGCCGCGCTTCCCCTTCGGCCGGC
CGGTGGAGACGTCGGCCGAGCAGTTCGCCAACTGGCTGCCCTACTCCGCCTACCTCTCTGCCGAGAAGAT
CTTCGTCAACCGCGACAGCATGGGCTTCCTGCTGGAACTCATGCCCCAGTCCGGCGCCGACGAGCGCATG
GCGGAAGTCCTGGTCTCGCTCTACGCCAACTGCCCGACCGGCACCGGCATCCAGTTCCACCTCTTCGCCT
CGCCCCAGGTGCGCGAGCCCTTGCGCCGCTACGCCAATTTGCGGGTCGAGGACGCGACCCAGGCCGAACA
GGCCAAAGCTTGGGGCCGCCCGGCCCGCAACGGCAACCTTTTCAGGAAGCTCGCCCGCCAGCGCGTCGGC
CACCTGCTGCAGGGCGCGCAGAAGTCCCTCACGGCGGGCTTCCACTACACGATCCGGGACTTTCGCCTGA
TGCTCTCCGTCGCCTTCCCGGGCGACGCAGAAGACCTCAACCGGCGCGACGAATTGATGGCGCTGCGCGA
CTCGATGTCCTCGACGCTGCGCTCGGCCTCCCTCCCGAACCGTGTCTGCGACGCCGCCGACCTGATCAAC
TGGTGCGCCCTCTTCACCAACCCGGATCGCATTTCGCAGACCGACGCTCCGGACCTTCACTACGACGACG
GGCGCGAGCTGCGCGACCAGATCGTGGACTTCGACACCATCCAGGACCCGCACCCGGGCGGCCTCACCTT
GTGGAAGGAAGCGAGCTCCGACGTGCTGGAGGCCCGCTTCTACTCGATCAAGAGCTTCCCGGAACGCTTC
GCGCTCTGGCAGATGGGTTCCCTCATCGGCGACCTGATGCAGCCGGCGCTGCAGTACAGCGCCCCCTTCC
TGCTGACTCTGGGCGTGCATGTGCTCGACCCCAACGTCACCAAGTCGGTGGTGACCGCTAACCATGTGCG
GGCGACGCAGAACGCCAAGTCGAAGATGGCCGACGTCATGCCCGACGTGAAAAAGAAGCTGGACGACTGG
ACGGCCGCGGCGGATGCCATCGACACCGGCGGCAGCCTGGTGAGCCTCTACCACCAGCTGGCGCTCTTCA
CAGCCCCAGACAAAGCGGTCGCCGCCCACGAAGCCGCCAACGCCATCTGGCGCGGCCGCGGTTTTCAGCT
CAACGCCGACGCCTACATGCACCGCCAGGCGTTGCTGGCCAGCCTTCCCATGACGCTGACCGAGAAGTTC
CACAGGGACCTGGTGAAGATGCGCCGGGTCACGCGCAAGACGATGGCCAACGCCATCCACATGGCGCCAC
TGATCGCCGAGTGGCGCGGCACGCGCACCCCCGCCTTGGTCTTCGGCGGCCGGCGTGGCCAGTTGATGAC
CCTGGACATCTTCGACAACGACCTGGGCAACTACAACTTCGCCATCATCGGCGCCCCCGGCTCCGGCAAG
TCGGTGCTGATGAACGAGATGGCCTGGTCCTACCGTGCCATCGGCGCCAAGGTCTGGATGCTCGACCTCG
GGCGCTCCTTCGAGAAGCTGTGCCGCAAGGCCCAGGGCACCTACATCGAGTTCCGCCCGGACGTCGACAT
CTGCCTCGACCCCTTCACCCACATCGTCGACATCAATGAAGACATCGACATGCTGGTGCCGGGCATCGCG
AAGATGTGCTCGATGCAGCACGCCCTCGAAGAGGTCCAGTACAAGGCGATCTCGGCGATGGTCTTGAAGC
TCTGGCGCGAATACGGCAACGGGCTGCGCATCACGGGACTGCGCGATGCCTTCAAGGGCGGGACCATCGA
GGAACTCGGCGTGGTCAATGATCAGCGCATCAAGGACCTCGCCATCATGCTCAACCCCTATGCGCGTGGC
GGGCAGTACGAGCGCTTCTTCGAGGGCCGCAACAACGTCGACTTTTCCAACGACTTCATCGTCATCGAGA
ACGAGGAGCTGAAGCGCCGGCCCGACCTCCATGCGGTAGTCAATATCCTGCTGCTGCACCGGATCACCGG
CGAGATGTATCTGACCCGCAACCGGCGCAAGGTGCTGTTCGTCGACGAGCTGAAGCAGCAGTTGGGCGAC
ATCGGCGCCGACGATCCCGTCAAGGCGGCCGTGATCGAGGAGGCGGCTCGGCGCGCCCGCAAGTACGGCG
GCGCGCTCGGCACGGCGACGCAAAGCGCCGACGACTTCTATGGCTCGGCCCAGATGGAAGCCGCCTTCAA
CTGCTCCGACTGGGTCTTCCTGCTGCGCCAGAAACCCGAGTCCATCGAGATGCTCGACCGCAAGGGCCGG
CTGACCATGGACGAGCCGAAAAAGCGCCTCTTGAACTCGCTGCGCACCGAGGCCGGCGTCTTCTCCGAGC
TCTACATCTCCTCGCCGGTGGGCGAAGGCGTGGCCCGCGCCATCCTCGATCCGGCCACCCATCTGCTGTT
CTCCAACAAGCTCGAGGACAACGCCCCCATCGACGAGTTGCGTGCCCGGGGCCTCTCGATCGATGAGGCG
ATCAGCGAACTGTTGCGGCGCCGGGGGCACGCGGTATGA
 Primer design