SecReT4
Protein ID: 56479220
T4SS name [ID]Tra_F [554]
Gene symboltraW
Locus tagebA6618
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]3924637..3925308 [+]
Producthypothetical protein
Component typeTraW_F
UniProt IDQ5NYF6
KEGG IDeba:ebA6618
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 223 a.a.     [Download]
>gi|56479220|ref|YP_160809.1| hypothetical protein ebA6618 [Aromatoleum aromaticum EbN1]
MGRAGALPGWEHAMTILKMLVVAAGPSLFVAHAAAMELGVIGPTYDVTEPHLLQMIEQRLREKERSGELK
RLEEHARSRGIETVKHPLPVAGLHATETARTFYVDPSFTLDRNILGPQGELLFAAGTRKNPLEVVSLSRH
LLFFDARDPRQVGRARQLMASYRGRVKPILVGGSYLELMKSWRIPIYYDQHGLLTRRLGIAQVPALVSQE
GLRLRIDELELAR
 
Nucleotide Sequence: 672 bp     [Download]
>gi|56475432|ref|NC_006513.1|:3924637-3925308 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGGGCCGGGCAGGTGCGCTGCCCGGGTGGGAGCACGCCATGACCATACTCAAGATGCTCGTCGTCGCGG
CGGGTCCGAGCCTGTTCGTGGCCCATGCCGCCGCCATGGAGCTGGGCGTGATTGGCCCGACCTACGACGT
CACCGAACCCCACCTGCTGCAGATGATCGAGCAACGCCTCCGGGAGAAGGAACGCAGCGGGGAACTGAAA
CGCCTCGAAGAGCATGCCCGATCCCGCGGCATCGAGACCGTGAAGCATCCGCTGCCGGTGGCGGGCCTGC
ACGCCACCGAAACCGCGCGGACCTTCTACGTCGATCCGAGCTTCACCCTCGATCGCAACATCCTCGGCCC
CCAGGGCGAACTGCTGTTTGCCGCCGGGACGCGCAAGAACCCGCTGGAGGTGGTGTCGCTGTCCCGGCAC
CTGCTGTTCTTCGACGCCCGCGACCCGCGCCAGGTGGGCCGGGCGCGGCAGCTGATGGCGTCGTACCGGG
GACGCGTCAAGCCGATCCTGGTCGGCGGTTCCTACCTGGAGCTCATGAAATCCTGGCGCATCCCCATCTA
CTACGACCAGCACGGCCTGCTCACGCGCCGCCTGGGCATCGCCCAGGTGCCGGCCCTGGTCTCCCAGGAG
GGACTGCGGCTGCGGATCGATGAACTGGAGCTCGCGCGATGA
 Primer design