SecReT4
Protein ID: 56479221
T4SS name [ID]Tra_F [554]
Gene symboltraU
Locus tagebA6622
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]3925305..3926330 [+]
Producthypothetical protein
Component typeTraU_F
UniProt IDQ5NYF5
KEGG IDeba:ebA6622
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.9e-77, Aligned region: 35..339
Protein Sequence: 341 a.a.     [Download]
>gi|56479221|ref|YP_160810.1| hypothetical protein ebA6622 [Aromatoleum aromaticum EbN1]
MTRRRPPMLPFVLALLLGLATLPARAAGAATCTGKFPNPITDICWSCILPISIGAARVANFGDQEDTDNP
SSPVCSCGVNPAIGLSIGFWEPARHVEAVRKPFCLVSLGGVDLDPGIPAPEAARFTRPEGDGDGGSFYQA
HFYVNPVMYWLEVVTDFPCLEKGSFDLAYLTEVDPLWNDDELTLILNPDAVLFANPIAIAACAADCVAAS
VGFGLKELFWCAGCQGGIYPLDGHVPYHLGGVRTAALMAQRLTAKMHRELIAWGWHGTPGLCGPYFEPVM
DKTAYKTQLTYPIPNTAKEAGRCCQPFGRTTVLWGAGKEYPVRGEDFAFMLFRKRNCCVGF
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|56475432|ref|NC_006513.1|:3925305-3926330 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGACCCGGCGACGTCCGCCCATGCTGCCCTTCGTCCTGGCGTTGCTCCTCGGCCTCGCCACCCTGCCGG
CCCGGGCCGCCGGCGCCGCCACCTGCACGGGCAAGTTCCCCAACCCGATTACCGACATCTGCTGGTCCTG
CATCCTGCCCATCAGCATCGGTGCCGCACGCGTCGCCAACTTCGGGGACCAGGAAGACACCGACAACCCG
TCCAGCCCAGTCTGCAGTTGCGGCGTCAATCCGGCCATCGGGCTCTCCATCGGCTTCTGGGAGCCCGCAC
GGCACGTCGAAGCGGTTCGGAAGCCCTTCTGCCTCGTCTCCTTGGGCGGCGTCGATCTCGACCCGGGCAT
CCCGGCGCCGGAGGCCGCGCGCTTCACCCGCCCGGAAGGCGATGGCGACGGCGGCAGCTTCTACCAGGCG
CACTTCTACGTGAACCCGGTGATGTACTGGCTGGAGGTGGTGACCGACTTCCCCTGCCTGGAAAAGGGTT
CGTTCGATCTCGCCTACCTCACCGAGGTCGATCCGCTGTGGAACGACGACGAGCTCACCCTGATCCTCAA
CCCGGACGCCGTGCTCTTCGCCAATCCCATCGCCATCGCCGCCTGCGCCGCCGACTGCGTCGCCGCCTCG
GTGGGCTTCGGCCTCAAGGAGCTCTTCTGGTGCGCCGGCTGTCAGGGCGGCATCTACCCGCTCGACGGCC
ACGTGCCCTACCACCTGGGCGGCGTGCGCACCGCCGCCCTCATGGCTCAGCGCCTGACCGCGAAGATGCA
CCGCGAACTGATCGCCTGGGGCTGGCACGGCACGCCCGGCCTGTGCGGACCGTACTTCGAGCCCGTCATG
GACAAGACCGCCTACAAGACCCAGCTCACCTATCCGATCCCCAACACCGCGAAGGAGGCTGGCCGTTGCT
GCCAACCCTTCGGCCGCACCACGGTGCTTTGGGGTGCGGGCAAGGAATACCCCGTGCGCGGCGAGGACTT
CGCCTTCATGTTGTTTCGCAAAAGGAACTGCTGTGTCGGCTTCTAA
 Primer design