SecReT4
Protein ID: 56479222
T4SS name [ID]Tra_F [554]
Gene symboltrbC
Locus tagebA6624
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]3926317..3927066 [+]
Producthypothetical protein
Component typeTrbC_F
UniProt IDQ5NYF4
KEGG IDeba:ebA6624
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 2e-34, Aligned region: 118..229
Protein Sequence: 249 a.a.     [Download]
>gi|56479222|ref|YP_160811.1| hypothetical protein ebA6624 [Aromatoleum aromaticum EbN1]
MSASNPVLPALPFAVVLAASAQTLAQNPPLVTDADIERVRREQPTISDQDIEQVRQRHRMPSDAELQAAP
VPTPPHIDALPTPAARAPIDLDALARGYASQAQEISRAEGLASGPGLLVFVSLSMPQPTLQRLIDQAARA
QASIVLRGFADGSLRTTVARVQRLIGDRQVAVQIDPQAFDRYAVTRVPAFVLVRDGARPVACAGGSCAPS
EIFLRTSGDVSLDYALEYMQRSAPGFGSAADTFLKRIRG
 
Nucleotide Sequence: 750 bp     [Download]
>gi|56475432|ref|NC_006513.1|:3926317-3927066 Aromatoleum aromaticum EbN1 chromosome, complete genome
GTGTCGGCTTCTAATCCCGTCCTTCCCGCCCTCCCCTTCGCTGTTGTGCTGGCGGCGAGCGCCCAGACCC
TGGCCCAGAACCCGCCGCTCGTCACCGACGCGGACATCGAACGGGTCCGTCGCGAACAGCCGACGATCTC
CGATCAGGATATCGAGCAGGTGCGGCAGCGACATCGCATGCCGAGCGACGCCGAACTGCAAGCCGCGCCG
GTGCCGACCCCACCCCACATCGACGCACTGCCGACGCCGGCGGCCCGTGCCCCGATCGATCTCGATGCGC
TCGCGCGGGGCTATGCATCGCAAGCGCAGGAGATAAGCCGAGCAGAGGGACTGGCGTCCGGGCCGGGACT
CCTGGTGTTCGTCAGCCTCTCCATGCCGCAGCCCACGCTGCAGCGCCTCATCGACCAGGCCGCACGCGCC
CAGGCTTCGATCGTCCTCCGGGGCTTCGCCGACGGGTCGCTGCGCACCACCGTCGCCCGGGTGCAGCGCC
TCATCGGCGACCGACAAGTGGCGGTGCAAATCGATCCGCAGGCCTTCGACCGCTATGCCGTCACCCGGGT
CCCGGCCTTCGTGCTGGTGCGCGATGGCGCCCGACCGGTCGCCTGCGCCGGTGGCAGCTGCGCGCCGTCC
GAGATCTTCCTGCGGACCTCCGGCGACGTGAGCCTGGACTACGCGCTGGAATACATGCAGCGGTCGGCAC
CCGGGTTCGGCTCGGCAGCCGACACCTTCCTGAAGCGGATTCGGGGATAG
 Primer design