SecReT4
Protein ID: 56479223
T4SS name [ID]Tra_F [554]
Gene symboltraN
Locus tagebA6625
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]3927157..3929508 [+]
Productconjugal transfer protein TraN
Component typeTraN_F
UniProt IDQ5NYF3
KEGG IDeba:ebA6625
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 8e-43, Aligned region: 397..562
TraN [PF06986], Evalue: 8e-43, Aligned region: 651..733
Protein Sequence: 783 a.a.     [Download]
>gi|56479223|ref|YP_160812.1| conjugal transfer protein TraN [Aromatoleum aromaticum EbN1]
MRRWVIWITLFCFVTTQTAAVAGPFEEGTAAGQAANPVIRGTVNAPSASSTVPGYTSTPPETTYYGQPSL
SGSANARLTACAIATGDPVCEAQRGAMTSANTPREAISPYDPAVSAARAIATYYSGCQVDSVATPATEDR
VCRQYSGTSPYSCTRSVSVSVSRTSSCTPGNWFANAASGRTGLDVQCIPDRPASQQHFRVTDRGTPLTYF
DLDMTTLLTFPRMVATLRSGSWSWWGSGQNGLWVADNQCVGDSCRLTAMVAQEYRRVCTDGGGDSGLGDC
TLERPFLEVYGACPSGTQSGDNILPWWGWGGDSSAFEASACYAPSATASGLIGYDVTGTVPGYFWTKDAQ
RPVVGWRINPAYRSIPQMVLNYERPHTTVTETDRWDDQCPALDAGGRCTVAGTARCVDGPATKEVNGAFV
SRDCWQYETTLACAQAAATDECAPLIAAGCAPAGTVCRQMNAATGICEITENTYTCPVPPGNTVTATNCP
ANVFCLAGNCFNTTYTNDADFARSMSLMEAAREGGVYLDTDNMQVFKGEGNRCRDRLFKNCCYSDSAGAG
MTNQSLFGTGSRLVYDVLMNADNREFLYQGMQALLLGGGFSGTFTTYGVTVAVNGAALPAGSAVLYAGDS
LVIAFDPWSLAIAVVIYIVMSMSSCNEEEGKLAMKEGAGLCHKVGTWCSSCIRVFGKCVACIEHTTGKCC
FNSKLARIVNEQGRVQVGKGWGSGKNPDCSGFTIAQLQRLDFAAMDLTEFYASIVPTLPNVGTIQGSNAA
RLTTCYYGQGKCQ
 
Nucleotide Sequence: 2352 bp     [Download]
>gi|56475432|ref|NC_006513.1|:3927157-3929508 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGCGTCGCTGGGTCATCTGGATCACGCTCTTCTGCTTCGTCACGACGCAGACCGCTGCCGTGGCCGGCC
CGTTCGAGGAAGGCACCGCTGCCGGCCAGGCGGCCAACCCGGTGATCCGGGGGACGGTCAATGCGCCGAG
CGCCTCGAGCACCGTCCCGGGTTATACCAGCACGCCGCCGGAAACCACGTATTACGGCCAGCCCAGTCTG
TCGGGGTCGGCCAATGCCCGCCTGACCGCCTGCGCCATCGCGACCGGCGACCCCGTCTGCGAGGCTCAGC
GCGGGGCGATGACGTCGGCCAACACGCCGCGCGAGGCCATCTCGCCCTACGACCCGGCAGTGAGCGCCGC
CCGAGCCATCGCCACCTATTACAGCGGCTGCCAAGTGGATAGCGTCGCCACACCCGCCACCGAAGACCGC
GTCTGCCGCCAGTACAGCGGCACCTCGCCGTACTCGTGCACGCGCTCCGTGAGCGTATCGGTGTCGCGCA
CCAGCAGTTGCACACCGGGCAACTGGTTTGCCAACGCCGCTTCGGGCCGCACCGGACTGGATGTGCAGTG
CATACCGGACAGGCCTGCCAGCCAACAGCATTTCCGCGTTACCGACCGGGGTACGCCCCTGACGTACTTC
GACCTCGATATGACCACGCTGCTGACGTTTCCCCGCATGGTCGCGACGCTCCGCAGCGGCTCATGGTCGT
GGTGGGGCAGCGGCCAGAACGGACTTTGGGTCGCCGACAACCAGTGCGTCGGCGACAGTTGTCGGCTGAC
CGCCATGGTTGCCCAGGAATACCGGCGCGTCTGCACCGACGGAGGTGGCGACTCGGGACTCGGGGACTGC
ACGCTGGAGCGCCCCTTCCTCGAAGTCTATGGTGCCTGCCCGTCCGGGACCCAGAGTGGCGACAACATCC
TGCCCTGGTGGGGCTGGGGCGGCGACAGTTCCGCCTTCGAGGCGTCCGCCTGCTATGCGCCGTCCGCGAC
GGCGTCCGGACTCATCGGCTATGACGTGACGGGCACCGTGCCCGGCTATTTCTGGACCAAGGACGCGCAA
CGTCCCGTGGTCGGCTGGCGGATCAATCCGGCCTATCGGTCGATCCCGCAGATGGTCCTGAACTACGAAC
GTCCCCACACCACGGTGACCGAAACCGATCGATGGGACGACCAGTGCCCTGCCCTGGACGCCGGTGGCCG
CTGCACGGTGGCGGGAACCGCGCGCTGCGTCGACGGCCCGGCCACCAAGGAGGTGAACGGCGCGTTCGTA
TCGCGTGACTGCTGGCAGTACGAGACGACGCTCGCCTGCGCGCAAGCCGCCGCGACTGACGAGTGCGCCC
CCCTCATTGCCGCCGGTTGTGCCCCCGCAGGCACCGTATGCCGGCAGATGAACGCGGCCACCGGCATCTG
CGAGATCACCGAGAACACCTACACCTGCCCGGTGCCGCCGGGCAATACCGTCACTGCAACGAACTGTCCG
GCGAACGTCTTCTGCCTCGCCGGAAACTGCTTCAACACCACCTACACCAACGACGCCGACTTCGCCCGTT
CGATGTCGCTGATGGAGGCCGCACGCGAAGGGGGCGTGTACCTCGACACCGACAACATGCAGGTGTTCAA
GGGTGAGGGTAACCGCTGCCGCGACCGGCTGTTCAAGAACTGCTGCTATTCCGACTCGGCTGGTGCCGGC
ATGACCAACCAGAGCCTGTTCGGCACCGGCTCGCGCCTGGTTTACGACGTGCTGATGAACGCCGACAACC
GCGAGTTCCTGTACCAAGGCATGCAGGCGCTGCTCCTCGGCGGGGGCTTCAGCGGCACCTTCACCACCTA
CGGCGTGACCGTGGCGGTCAATGGCGCCGCCCTGCCCGCCGGCTCAGCGGTCCTCTATGCGGGGGACAGC
CTGGTGATCGCCTTCGATCCGTGGTCGCTCGCCATCGCCGTGGTCATCTACATCGTCATGTCCATGTCGT
CCTGCAACGAGGAGGAAGGCAAGCTCGCGATGAAGGAAGGGGCCGGACTCTGCCACAAGGTTGGCACTTG
GTGCTCGTCGTGCATCCGCGTTTTCGGCAAATGCGTCGCCTGCATCGAGCACACCACCGGCAAGTGCTGC
TTCAACAGCAAGCTCGCGCGCATCGTCAACGAACAGGGCCGCGTACAGGTGGGCAAGGGCTGGGGCTCCG
GCAAGAACCCCGACTGCTCGGGCTTCACCATCGCGCAGCTCCAGCGCCTCGATTTCGCAGCGATGGACCT
CACGGAATTCTATGCCTCCATCGTCCCGACGCTCCCCAATGTCGGAACGATCCAGGGCAGCAATGCTGCG
CGCCTCACCACCTGCTACTACGGACAGGGGAAATGCCAATGA
 Primer design