SecReT4
Protein ID: 56479225
T4SS name [ID]Tra_F [554]
Gene symboltraF
Locus tagebA6633
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]3929886..3930731 [+]
Producthypothetical protein
Component typeTraF_F
UniProt IDQ5NYF1
KEGG IDeba:ebA6633
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.3e-69, Aligned region: 41..259
Thioredoxin_8 [PF13905], Evalue: 1.2e-06, Aligned region: 166..205
AhpC-TSA [PF00578], Evalue: 3.8e-06, Aligned region: 148..204
Thioredoxin_2 [PF13098], Evalue: 1.3e-05, Aligned region: 165..259
Protein Sequence: 281 a.a.     [Download]
>gi|56479225|ref|YP_160814.1| hypothetical protein ebA6633 [Aromatoleum aromaticum EbN1]
MKRFAFPAPLRLLLALALLLGADAASAQDATARYWSDSWRGWHFYEDPPAAERERPTLPEQTVPLAPTSG
APELVEFERLQKTLEDTRNIAIMRPTEANVRRYMELESQVVARASYFADVAQRVAWATPELDPTLQGRPV
NAKALEVFEQTQQVGRSRAIADLGKDHVLLFFYRSDCPYCHAFAPILAAFQARHGIQVVAVSMDGGPMPG
FPEARPDNGIATTLKVTQVPAIFLAQPFTGRITPIGFGVLSESQLLERLAVVSTPQGEAMLPSATRQIDL
R
 
Nucleotide Sequence: 846 bp     [Download]
>gi|56475432|ref|NC_006513.1|:3929886-3930731 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGAAACGCTTCGCGTTCCCCGCACCCTTGCGATTGCTGCTGGCGCTGGCCTTGCTGCTGGGCGCCGACG
CGGCGTCGGCCCAGGATGCCACTGCGCGCTACTGGTCCGACAGTTGGCGCGGCTGGCATTTCTATGAGGA
CCCACCGGCCGCGGAACGAGAACGCCCGACGTTGCCGGAGCAGACTGTGCCCTTGGCTCCGACCTCGGGA
GCGCCGGAACTGGTCGAGTTCGAACGTCTGCAGAAAACCCTGGAGGACACGCGCAACATCGCCATCATGC
GACCGACCGAGGCGAACGTGCGGCGCTACATGGAACTCGAGTCCCAGGTCGTCGCCCGTGCCTCCTATTT
CGCCGACGTCGCCCAGCGGGTGGCCTGGGCGACGCCCGAGCTCGATCCGACCCTGCAGGGTCGACCGGTC
AACGCCAAGGCGCTGGAGGTGTTCGAGCAGACCCAGCAGGTCGGGCGTTCCCGCGCGATCGCCGATCTGG
GCAAGGACCATGTGCTGCTCTTCTTCTATCGCTCGGACTGCCCGTACTGCCATGCCTTCGCACCGATCCT
GGCCGCCTTTCAGGCGCGCCACGGCATCCAGGTCGTCGCCGTCAGCATGGACGGCGGTCCGATGCCGGGC
TTCCCCGAGGCGCGCCCGGACAACGGCATCGCCACCACCCTGAAGGTCACCCAGGTGCCCGCCATCTTCC
TGGCCCAACCCTTCACCGGAAGGATCACGCCCATCGGCTTCGGCGTGCTCTCCGAATCCCAGTTGCTGGA
GCGTCTCGCCGTCGTCTCGACTCCGCAGGGCGAGGCAATGCTGCCCAGCGCGACGCGGCAGATCGACCTT
CGTTAG
 Primer design