SecReT4
Protein ID: 56479226
T4SS name [ID]Tra_F [554]
Gene symboltraH
Locus tagebA6635
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]3930743..3932203 [+]
Producthypothetical protein
Component typeTraH_F
UniProt IDQ5NYF0
KEGG IDeba:ebA6635
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.1e-100, Aligned region: 41..400
Protein Sequence: 486 a.a.     [Download]
>gi|56479226|ref|YP_160815.1| hypothetical protein ebA6635 [Aromatoleum aromaticum EbN1]
MSTLPRPTLPSITRWTSAFALAAVLVATSAPLHAGDLNAEVNDMFNNLGAIGNYTAPGAFRGQTFNTYAG
GNLMMRSPNKVYQLAAIQFPSAKAGCGGIDVFGGSFSHISAEEFKNMLRNITAALPGIAFQLALEAVSPL
LGGLTKWAKGLETWINNARINSCETAKAIVSTAAESLGYSSQETCADLAIEMGLESDRDAARRRCATDRP
SILSSARASSDPNVKNKAPFVGNLTWKALQYTGAYLDDQERELIMSMVGTIIYYPEESARDPEPIAPTLT
SISQLLYGQSAASGTDVIQHMLKCNDYTNCDVVSLNTTYTHTPFTAKVETMMRSIAEKIASRTAIPNNSA
EVGFVNQTTEPVYRMLSIGTSIPGSGLSDSLIAQYRDVIAADYAYVFLERNLRLGMAALDKNYTLQQTQR
EQANQVRQRAQAMLLQISQEKNLLYQKVGSFRAVSSHLEQLERQLRSSMPQHVMDMLGQQAAYLAQ
 
Nucleotide Sequence: 1461 bp     [Download]
>gi|56475432|ref|NC_006513.1|:3930743-3932203 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGTCCACCCTGCCACGCCCGACGCTCCCTTCCATTACCCGCTGGACGAGCGCGTTCGCGCTGGCCGCGG
TGCTGGTCGCCACGTCCGCTCCCCTGCACGCCGGCGACCTCAACGCGGAGGTTAACGACATGTTCAACAA
CCTCGGCGCCATCGGCAATTACACCGCGCCCGGCGCCTTCCGCGGCCAGACCTTCAACACCTATGCCGGC
GGCAACCTGATGATGCGCTCGCCCAACAAGGTCTATCAACTCGCCGCCATCCAGTTCCCCAGCGCCAAGG
CGGGTTGCGGCGGCATCGACGTCTTCGGCGGCAGCTTCAGCCACATCTCGGCCGAGGAATTCAAGAACAT
GCTGAGAAACATCACCGCCGCCCTGCCCGGCATCGCCTTCCAGTTGGCGCTCGAAGCCGTCTCGCCGCTA
CTGGGCGGTCTCACCAAATGGGCCAAGGGCCTGGAGACCTGGATCAACAATGCCCGCATCAACTCGTGCG
AGACCGCCAAGGCCATCGTCAGCACCGCCGCCGAGTCGCTCGGCTACAGCTCGCAGGAAACCTGCGCCGA
CCTCGCCATCGAGATGGGTCTGGAGAGCGACCGCGATGCGGCGCGCCGGCGCTGTGCCACCGACCGGCCC
AGCATCCTGTCCTCGGCGCGGGCCTCCAGCGATCCGAATGTGAAGAACAAGGCCCCCTTCGTCGGCAACC
TCACCTGGAAAGCGTTGCAGTACACCGGCGCCTATCTCGACGATCAGGAGCGCGAGCTGATCATGAGCAT
GGTCGGCACGATCATCTACTACCCGGAGGAATCGGCCCGTGATCCCGAGCCGATCGCGCCCACGCTCACT
TCGATCAGCCAGTTGCTCTATGGCCAGAGCGCAGCGAGCGGCACGGACGTCATCCAGCACATGCTGAAGT
GCAACGACTACACCAACTGCGACGTGGTCAGCCTGAACACCACCTATACCCACACGCCCTTCACCGCCAA
GGTCGAGACGATGATGCGCTCCATCGCGGAGAAGATCGCCTCGCGCACCGCCATCCCCAACAACTCGGCC
GAGGTCGGCTTCGTGAACCAGACCACTGAGCCGGTCTACAGGATGCTGTCCATCGGCACCAGCATCCCGG
GTTCGGGGCTGTCCGACAGCCTGATCGCCCAGTATCGCGACGTCATCGCCGCCGACTACGCCTACGTATT
CCTCGAACGCAACCTGCGTCTGGGCATGGCCGCCCTGGACAAGAACTACACGCTGCAGCAAACGCAACGC
GAGCAGGCCAATCAGGTCCGCCAGCGCGCCCAGGCGATGCTCCTGCAAATCTCGCAGGAGAAGAACCTGC
TGTACCAGAAGGTGGGCTCCTTCCGGGCCGTGTCGAGCCACCTGGAACAGCTCGAACGCCAGCTGCGTTC
CAGCATGCCGCAGCACGTGATGGACATGCTCGGCCAGCAGGCCGCCTATCTGGCGCAGTAG
 Primer design