SecReT4
Protein ID: 56479227
T4SS name [ID]Tra_F [554]
Gene symboltraG
Locus tagebA6638
StrainAromatoleum aromaticum EbN1
Repliconchromosome [GenBank: NC_006513] [Browse all T4SS(s) in this replicon]
Location [Strand]3932237..3934942 [+]
Producthypothetical protein
Component typeTraG_F
UniProt IDQ5NYE9
KEGG IDeba:ebA6638
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 3.8e-111, Aligned region: 3..468
Protein Sequence: 901 a.a.     [Download]
>gi|56479227|ref|YP_160816.1| hypothetical protein ebA6638 [Aromatoleum aromaticum EbN1]
MWEIYAYQNADSLFGVFNAAAAIHASGDYAAAVAAVAFCGFVAALIAYAFAPEKLQGWKWLGTVVLVFSV
LIVPKVTVGIVDKTGGSAVKVVDNVPFGVALLGSLTSTIGHTLTGLFETAFQVIPGIGALPAELAYQQNG
LMFGNRLIRETGNVVFQDPAFRTDLINFIHNCTTYDLIDGTLDPAAFSTSDDVWPLMASPNPARFSTLTS
TGGSVGVDTCPNVYQSLNGRLPAQITRIEGRLALQLNPTLPGAAAAAAIAGQIQQAYLKNSIATAAATAA
DLIRQNAMLNAIDDTSKIVGQKVNDPAAMVLAVGRAQAVAQQNATWLNYGKVAEQALPVFRNVVEAVTYA
MFPLFLLLLLLTSGRETMIAFKGYAAVLIWIQLWPPLYAILNYMASIYAAYDLAAAADLGTGAKALALQT
ASTIYSRAISGEAVVGYLAMSIPFIAWAALKRMENFGTALVGGLSGLQAMISGGTSASAVGNISMGNVGM
DQMHLAPNRTSAFMHSWQNDLSGNTFSSNVLTGRTAVSLLRNQGFASRMVSMRVSEQDVVQASRQADAAR
GEAISANTERSAALTETFTRGLAKLRSLRSSSGTVSSSFEQIGETLNRLDQISKNVADSTGLTQSQVAQI
AFGAAGHLGINTPVAGAELQARAGKNYMSGLSAAQQKVLNSLTQEQIAEFKQFGDRVSRDSSLINSFAKD
SREAQDMSSRLASVMSRAERPMPLSPKERPLQSVSHWPGTAENPFPLISPRTRTTWRCSCATPSSMAATA
PRRSPCLRQNSLAKASGQTGCFPMARLYPLPSTTCASCTTGMPRTRLCRPISRPRINSTARQLRALTDPR
RALTRTRARLRCETTYRLRARPSGMKPLRPDPPLTERQRSSTPQMAPWPPRNPCSSNRASR
 
Nucleotide Sequence: 2706 bp     [Download]
>gi|56475432|ref|NC_006513.1|:3932237-3934942 Aromatoleum aromaticum EbN1 chromosome, complete genome
ATGTGGGAGATCTATGCCTACCAGAATGCCGACAGCCTGTTCGGCGTCTTCAACGCAGCGGCGGCCATCC
ATGCGTCGGGCGACTACGCGGCGGCAGTGGCGGCGGTGGCCTTCTGCGGCTTCGTCGCCGCCCTCATCGC
CTATGCCTTCGCCCCCGAGAAACTGCAGGGCTGGAAGTGGCTGGGTACGGTGGTACTGGTCTTCTCGGTG
CTGATCGTGCCCAAGGTGACCGTCGGCATCGTGGACAAGACGGGCGGCTCAGCGGTCAAGGTGGTCGACA
ACGTGCCCTTCGGCGTGGCCTTGCTGGGCAGTCTCACCAGCACCATCGGCCACACCCTGACCGGGTTGTT
CGAGACGGCCTTCCAGGTCATCCCCGGCATCGGGGCGCTTCCGGCCGAGCTCGCCTACCAGCAGAACGGA
CTGATGTTCGGTAACCGCCTGATCCGCGAGACCGGCAACGTGGTATTCCAGGACCCGGCGTTCCGCACCG
ACCTCATCAACTTCATCCACAACTGCACGACCTACGACCTCATCGACGGCACCCTCGATCCGGCCGCATT
CTCCACGTCGGACGATGTCTGGCCGTTGATGGCTTCGCCCAACCCTGCGCGCTTCAGCACTCTCACCAGC
ACGGGCGGCAGTGTCGGCGTCGACACCTGCCCCAACGTCTATCAGAGCCTCAACGGGCGACTGCCGGCTC
AGATCACTCGTATCGAGGGGCGACTCGCCCTCCAGCTCAATCCGACCTTGCCGGGCGCCGCGGCGGCGGC
GGCCATCGCCGGGCAGATCCAGCAGGCCTATCTCAAGAACAGCATCGCCACCGCCGCGGCGACCGCCGCC
GATCTCATCCGGCAGAACGCCATGCTCAATGCAATCGACGACACCAGCAAGATCGTCGGCCAGAAGGTGA
ATGACCCGGCGGCCATGGTGCTGGCGGTCGGCCGTGCCCAAGCCGTGGCCCAGCAGAACGCGACCTGGCT
CAACTACGGGAAGGTGGCCGAGCAGGCCTTGCCGGTGTTCCGCAACGTGGTCGAGGCGGTGACCTACGCG
ATGTTCCCGCTCTTCCTCCTGCTCCTCCTGCTTACCAGCGGCCGCGAGACCATGATCGCCTTCAAGGGTT
ACGCGGCGGTGCTGATCTGGATCCAACTCTGGCCCCCGCTCTACGCCATCCTCAACTACATGGCCTCGAT
CTACGCGGCCTACGATCTGGCGGCCGCGGCGGACCTCGGTACCGGCGCCAAGGCGCTGGCCCTGCAGACC
GCCTCCACGATCTATTCGCGTGCGATCTCGGGCGAAGCCGTCGTCGGCTACTTAGCGATGAGTATCCCCT
TCATTGCCTGGGCGGCCTTGAAGCGCATGGAGAATTTTGGGACGGCGCTGGTCGGCGGCCTGTCGGGCCT
GCAGGCGATGATCTCGGGTGGCACCTCGGCCTCGGCCGTCGGCAACATTTCCATGGGGAACGTGGGGATG
GACCAGATGCACCTGGCGCCCAACCGCACCTCGGCCTTCATGCACAGCTGGCAAAACGACCTGAGCGGGA
ACACCTTCTCGTCGAATGTGCTGACCGGACGGACGGCCGTCAGCCTGCTGCGCAACCAGGGCTTTGCGTC
GCGGATGGTCTCGATGCGGGTGTCCGAGCAGGACGTGGTGCAGGCCAGTCGGCAAGCCGATGCCGCGCGC
GGCGAAGCAATCTCCGCAAATACCGAGCGATCGGCGGCGCTCACCGAGACCTTTACACGAGGCCTGGCAA
AACTGCGATCCCTCCGCAGCAGCAGCGGCACAGTCTCAAGCAGCTTCGAGCAGATAGGCGAGACACTCAA
CCGGCTGGATCAGATCTCGAAAAACGTGGCGGACAGCACGGGCCTGACCCAGAGCCAAGTGGCGCAGATT
GCCTTCGGTGCTGCCGGCCACCTGGGGATCAATACCCCCGTAGCGGGCGCGGAACTTCAGGCCCGCGCCG
GGAAGAACTACATGTCGGGTCTATCGGCTGCCCAGCAGAAGGTGCTCAACAGCCTCACACAAGAGCAGAT
TGCAGAGTTCAAGCAGTTTGGCGATCGGGTGTCGAGGGATTCGAGCCTCATCAACAGCTTCGCCAAGGAC
TCCCGCGAGGCCCAGGACATGTCGTCGCGGCTCGCCAGCGTTATGTCTCGAGCCGAGCGGCCGATGCCAC
TTTCGCCGAAAGAACGGCCTTTGCAGAGCGTCTCTCACTGGCCAGGGACCGCGGAGAATCCCTTTCCATT
GATATCGCCCAGGACCCGCACAACCTGGAGATGTTCCTGCGCTACGCCGAGCAGTATGGCGGCGACAGCG
CCTCGGCGCTCTCCATGTTTGAGGCAGAACTCGCTCGCCAAGGCCTCAGGCCAAACCGGGTGTTTTCCGA
TGGCACGGCTCTACCCACTTCCTTCGACGACGTGCGCGTCCTGCACGACCGGCATGCCTCGGACCCGACT
CTGTCGCCCGATCTCTCGGCCTCGGATCAACAGCACCGCGCGACAGTTGCGCGCTCTAACCGACCCACGC
CGAGCGCTCACTCGGACACGAGCCCGCCTTCGCTGCGAAACGACGTACAGACTGAGGGCAAGGCCATCAG
GAATGAAACCGCTTCGGCCAGATCCACCTTTGACCGAAAGGCAGAGATCGTCGACACCGCAGATGGCACC
TTGGCCACCAAGAAATCCCTGCTCAAGCAATCGGGCAAGCAGGTAG
 Primer design