SecReT4
Protein ID: 56550566
T4SS name [ID]Trb [612]
Gene symbol-
Locus tagRMe0008
StrainCupriavidus metallidurans CH34 plasmid pMOL28 (NC_006525)
Repliconplasmid pMOL28 [GenBank: NC_006525] [Browse all T4SS(s) in this replicon]
Location [Strand]10158..12026 [-]
Producthypothetical conjugative coupling factor protein
Component typeTraG
UniProt IDQ5NV49
KEGG IDrme:Rmet_6309
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 4e-18, Aligned region: 474..600
TrwB_AAD_bind [PF10412], Evalue: 7.6e-17, Aligned region: 166..213
TrwB_AAD_bind [PF10412], Evalue: 7.6e-17, Aligned region: 472..610
AAA_10 [PF12846], Evalue: 1.8e-10, Aligned region: 176..548
T4SS-DNA_transf [PF02534], Evalue: 2.8e-08, Aligned region: 420..602
DUF87 [PF01935], Evalue: 7e-07, Aligned region: 162..220
Protein Sequence: 622 a.a.     [Download]
>gi|56550566|ref|YP_161632.1| hypothetical conjugative coupling factor protein [Cupriavidus metallidurans CH34]
MMNHYINHFRPIYEFRAAVGWTVAALLILLSGMPHAGYFALLCLCALLLRSAQVWRALRFRLAISTKWLT
VVKIDDLLDASRGLRSKDKDVDAMYLGTGYEWTQKHCQLAHDILRMPSTDIPGLPKWLPNETVRAIEKAF
APANSIADHSPQGKPWIAGLETKKQPVPFHYKAMGGHTSISGTTGAGKTRTFELISTQVIHNPNDVLIVI
DPKNDVEWVARCRRECERTGRKFLYWKQAAPSQSIRLNPLENWSQPSEIPTRVAQLMEEGPFRQFAFLFI
DRSVKGELYVGDKPNLRSILQYAQNGINNLLERALQRFFPEAGMTDWEDEVAGYMQQVGQKGGGTRLDAM
VRLYIDRFSNLGKGHESIDGLISTFQHDRDHYGRIIASALPLLQMLATGETGLMLAPKADDFEDDREIWD
IDKVIKQKAVLYVGADSLSNSMVAQAVMSMLLADIASVAGAIYNFYAKPPEIVLQVDETAEAINEQLLQL
LNKGRGAGFKAFVAYQTRSDFTAKLGNVAKMQQVLGNLNNQIVLRLEDIDTAQWFAEKAGTTAIRNLVIS
SSTSTGTEAHVGEFSGSVSRSAQLEKVPLIPHDLVMQLPNLQYFLRISGGAVYQGRIPIIQD
 
Nucleotide Sequence: 1869 bp     [Download]
>gi|56550557|ref|NC_006525.1|:c12026-10158 Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence
ATGATGAATCACTACATCAACCATTTCCGGCCCATTTACGAATTTCGCGCGGCCGTTGGCTGGACCGTCG
CAGCTTTGTTGATTCTGTTGAGCGGCATGCCGCACGCTGGCTATTTCGCGCTCTTGTGCCTATGTGCCCT
ACTGCTACGGTCCGCGCAGGTTTGGCGCGCCCTCAGATTCCGACTCGCCATTTCCACCAAGTGGCTTACC
GTGGTCAAGATCGATGATCTTCTCGATGCCAGCCGCGGTCTCCGCTCGAAGGACAAAGACGTGGACGCCA
TGTACCTCGGCACCGGCTACGAATGGACCCAGAAGCACTGTCAACTTGCGCACGATATTCTGCGCATGCC
GTCCACCGATATTCCCGGCTTGCCAAAATGGTTGCCGAACGAAACGGTACGTGCCATCGAAAAGGCCTTT
GCTCCCGCCAACAGCATTGCGGACCATTCGCCTCAAGGCAAACCTTGGATTGCGGGTCTGGAGACCAAGA
AGCAGCCAGTGCCGTTTCACTACAAGGCGATGGGCGGCCACACGTCCATCAGCGGCACCACCGGTGCGGG
CAAGACGCGCACATTCGAACTGATTTCCACGCAGGTTATTCATAACCCTAATGACGTTTTGATCGTGATC
GATCCGAAGAACGACGTCGAGTGGGTCGCAAGATGCCGGCGAGAATGCGAGCGTACGGGTCGGAAGTTTC
TGTATTGGAAGCAGGCGGCGCCGTCCCAATCCATCCGTTTGAATCCACTGGAAAACTGGTCGCAACCGTC
GGAGATACCCACGCGCGTCGCCCAGCTCATGGAGGAAGGCCCGTTCCGGCAGTTTGCGTTCCTGTTCATC
GATCGTTCTGTCAAAGGCGAGCTCTACGTCGGCGACAAGCCCAACCTGCGCTCCATCCTCCAATACGCAC
AGAACGGTATCAACAACCTGCTCGAGCGTGCGCTTCAGCGCTTTTTCCCCGAAGCCGGCATGACGGACTG
GGAAGACGAGGTCGCCGGATACATGCAGCAAGTCGGTCAGAAAGGTGGCGGTACCCGTCTGGACGCTATG
GTTCGACTGTATATCGACCGCTTCTCGAATCTGGGCAAGGGCCACGAGTCGATCGACGGTCTCATCTCGA
CGTTTCAACACGATCGAGACCACTACGGCCGTATCATCGCCTCTGCCCTGCCCCTCCTGCAGATGCTGGC
CACCGGCGAGACCGGCCTCATGCTAGCGCCCAAAGCGGATGACTTCGAGGACGATAGAGAAATCTGGGAT
ATCGACAAGGTCATCAAACAGAAGGCCGTGCTCTACGTCGGTGCGGACTCCCTGTCGAACTCCATGGTCG
CGCAAGCGGTGATGTCCATGCTGCTCGCGGACATCGCTTCGGTCGCTGGCGCGATCTACAACTTCTACGC
GAAGCCTCCCGAGATCGTCCTTCAAGTTGACGAAACGGCTGAGGCCATCAACGAGCAGTTGCTCCAGCTT
CTCAACAAGGGGCGTGGTGCAGGCTTCAAGGCGTTCGTTGCTTACCAGACGCGTTCCGATTTCACGGCAA
AACTTGGAAACGTGGCCAAAATGCAGCAGGTTTTGGGCAATCTGAACAACCAGATCGTTCTACGCTTGGA
AGACATCGACACCGCGCAGTGGTTCGCCGAGAAGGCCGGGACGACGGCTATCCGCAACCTGGTGATCTCC
AGCAGCACGAGTACCGGCACGGAAGCGCACGTAGGTGAATTTAGTGGCTCCGTTTCGCGATCCGCACAGC
TTGAAAAGGTACCCCTGATTCCGCATGACCTGGTCATGCAACTGCCGAACCTCCAGTACTTCCTACGGAT
ATCCGGCGGCGCCGTCTACCAAGGTCGTATTCCAATTATTCAGGACTAA
 Primer design