SecReT4
Protein ID: 56550568
T4SS name [ID]Trb [612]
Gene symboltrbL
Locus tagRMe0010
StrainCupriavidus metallidurans CH34 plasmid pMOL28 (NC_006525)
Repliconplasmid pMOL28 [GenBank: NC_006525] [Browse all T4SS(s) in this replicon]
Location [Strand]13264..14316 [-]
Productconjugal transfer protein trbL
Component typeTrbL
UniProt IDQ5NV47
KEGG IDrme:Rmet_6307
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1e-28, Aligned region: 96..319
Protein Sequence: 350 a.a.     [Download]
>gi|56550568|ref|YP_161634.1| conjugal transfer protein trbL [Cupriavidus metallidurans CH34]
MQIARFIVLLLTALLLHSPPAFAQASAPEAGTDTAQQTAPNKGGKPGLFAQPGSIGESLKSWLSQFESFR
TGLIGGATTLSKTLTPDADKIAFGLAVISLTLAGIRFAAASQPVAAWTEVFETLLMLGIFASLYTGYDKF
GPGIYEYFQHLADKIAGTQAMSPAMTLASVGAGFIDSYIESMKAASGISDVLMIAFAGMLLLAAFVFCAL
AALLYTFFISLGEIAAAIGIVIGPIAVALGFSDYSRRYFSSWLDYMIGASMYSVVAAVMARLVSSALVST
LIDQKSAGTATLAGAVYAMSIALFMILVAFELPKIAGAIFGSGGGISGGGAMRVGLKAAGGIGKFLAKLK
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|56550557|ref|NC_006525.1|:c14316-13264 Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence
ATGCAGATCGCCCGCTTCATCGTCTTGCTTCTGACGGCCCTTCTATTGCATTCGCCGCCGGCTTTCGCAC
AAGCGTCCGCCCCTGAAGCGGGCACCGACACCGCACAGCAAACTGCCCCGAACAAGGGTGGCAAGCCCGG
GCTATTCGCGCAGCCGGGATCGATTGGTGAATCGCTCAAGAGCTGGCTCAGCCAGTTCGAATCGTTCCGT
ACCGGTCTGATCGGGGGCGCCACCACATTGAGCAAGACCCTCACTCCGGACGCGGACAAGATCGCCTTCG
GGCTTGCCGTCATTTCGCTGACGTTGGCTGGAATTCGTTTCGCCGCGGCGTCGCAACCTGTCGCGGCCTG
GACCGAGGTCTTCGAGACGCTCCTTATGCTTGGCATCTTCGCGTCCCTCTACACCGGATATGACAAGTTC
GGGCCTGGCATTTACGAATACTTCCAGCATCTCGCCGACAAAATCGCAGGCACACAAGCGATGTCACCTG
CGATGACGCTCGCTTCCGTCGGCGCCGGATTCATTGATTCCTATATTGAGTCTATGAAGGCGGCAAGCGG
TATCTCAGACGTCTTGATGATAGCGTTTGCTGGAATGCTGTTGCTGGCTGCGTTCGTTTTTTGCGCCCTC
GCAGCTCTTCTCTACACGTTTTTCATATCCCTGGGCGAGATTGCGGCAGCCATCGGAATTGTAATTGGAC
CTATCGCAGTCGCCCTCGGATTCTCCGACTATAGCCGTCGCTACTTCTCTTCGTGGCTGGACTATATGAT
CGGCGCATCGATGTATTCGGTCGTTGCCGCTGTGATGGCTCGCCTCGTCTCGAGTGCACTGGTGTCCACG
CTTATCGATCAGAAGAGCGCCGGCACAGCGACGCTGGCTGGTGCCGTGTATGCCATGAGCATTGCGCTGT
TCATGATTCTTGTCGCCTTCGAGCTTCCTAAAATCGCCGGTGCGATCTTCGGCTCCGGTGGTGGCATCAG
CGGCGGTGGGGCCATGCGGGTTGGCCTCAAGGCCGCCGGCGGCATCGGCAAGTTCCTTGCGAAGTTGAAA
TAA
 Primer design