SecReT4
Protein ID: 56550569
T4SS name [ID]Trb [612]
Gene symboltrbJ
Locus tagRMe0011
StrainCupriavidus metallidurans CH34 plasmid pMOL28 (NC_006525)
Repliconplasmid pMOL28 [GenBank: NC_006525] [Browse all T4SS(s) in this replicon]
Location [Strand]14329..15087 [-]
Producthypothetical entry exclusion protein A precursor TrbJ
Component typeTrbJ
UniProt IDQ5NV46
KEGG IDrme:Rmet_6306
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 252 a.a.     [Download]
>gi|56550569|ref|YP_161635.1| hypothetical entry exclusion protein A precursor TrbJ [Cupriavidus metallidurans CH34]
MKKWIANLAVAASVLGAAPAHAALPVTDWVGLVQTTISALQSIKSEVYENTNIVYQYQMMANQLLQATGL
DAEAITEQFNSIKDEIGKYEVYGTTLKDLYGTVSDNADYLKKIQSMVVSSGKTKEQWFEDQRSLLTNGDK
TAKALFSLGEQIFKNTQSVAKRRQKIQSQIKLSATAQAAAQTTNQMLDVLASQNSDLLQLMSVRAQADAD
RDQQTVAKETQSAEAMRSLAAAQDEELKNLRARVFSRKLQSN
 
Nucleotide Sequence: 759 bp     [Download]
>gi|56550557|ref|NC_006525.1|:c15087-14329 Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence
GTGAAGAAGTGGATCGCCAACCTTGCCGTCGCCGCGTCCGTGCTCGGCGCCGCCCCCGCTCACGCCGCCC
TACCCGTCACCGACTGGGTGGGTCTGGTGCAAACCACGATCTCGGCGTTGCAGTCCATCAAGTCCGAGGT
GTACGAGAACACCAACATCGTCTACCAGTACCAGATGATGGCGAATCAGTTGCTGCAAGCTACAGGTCTG
GATGCAGAGGCCATCACCGAGCAGTTCAACAGCATCAAAGACGAGATCGGAAAGTACGAGGTGTACGGCA
CCACGCTCAAGGACCTCTATGGCACCGTCTCCGACAACGCCGACTATCTGAAGAAGATTCAGAGCATGGT
CGTCTCGTCCGGCAAGACGAAGGAACAGTGGTTCGAAGATCAGCGCTCCCTCCTGACCAACGGCGACAAA
ACTGCCAAGGCGCTCTTCAGCCTGGGCGAGCAGATCTTCAAGAACACACAATCGGTCGCCAAGCGCCGCC
AGAAGATCCAGTCGCAAATCAAGCTTTCGGCAACCGCGCAAGCTGCCGCGCAAACCACGAACCAGATGCT
CGACGTATTGGCGAGCCAGAACTCCGATTTGCTACAGCTCATGAGTGTGCGTGCCCAGGCCGACGCCGAT
CGGGACCAACAGACCGTTGCCAAGGAGACCCAGAGCGCAGAAGCGATGCGATCACTGGCAGCCGCTCAAG
ATGAAGAGCTCAAGAACCTCCGGGCCCGCGTCTTCTCCCGCAAGCTGCAGTCCAACTGA
 Primer design