SecReT4
Protein ID: 56550570
T4SS name [ID]Trb [612]
Gene symboltrbE
Locus tagRMe0012
StrainCupriavidus metallidurans CH34 plasmid pMOL28 (NC_006525)
Repliconplasmid pMOL28 [GenBank: NC_006525] [Browse all T4SS(s) in this replicon]
Location [Strand]15104..17560 [-]
Producthypothetical protein
Component typeTrbE
UniProt IDQ5NV45
KEGG IDrme:Rmet_6305
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 2.6e-18, Aligned region: 196..296
CagE_TrbE_VirB [PF03135], Evalue: 2.6e-18, Aligned region: 299..407
AAA_10 [PF12846], Evalue: 2.7e-18, Aligned region: 467..745
TraG-D_C [PF12696], Evalue: 7.6e-05, Aligned region: 681..747
Protein Sequence: 818 a.a.     [Download]
>gi|56550570|ref|YP_161636.1| hypothetical protein RMe0012 [Cupriavidus metallidurans CH34]
MLKLKRRPLAEIAPWLTSITPELILNKDGSLLANYEFRGVDADSADASDITSARDQLDQACRSFDNRITA
WWRLTHRRTKGYVDGEFSNGTDARLDALNRAHMTTGRYYRNAHSLSIAYTPETGVAKFFEKIGHHMTVGG
KPIFAALLEATKDTVLARSAFAFDMEKIRSDTRRFEAMLDAFTGGIPRIKPTRLAMQDSYAALHQVANPS
VPKRRIRFPVTMLDTHLSESEITVGSERLLFESAHGKRYAAIVAVKEWMSFQEAALDTLLQVDAELDICI
MYRFLDTARATAYIEKVRRFYKMAAVNLRSMVQQYMSKEENENDEGREELAKEAGKALKRLTAEGVQHGF
ANISIVVYADTEAECEDAVSEVVGTLTNAGFGAIREKTNLMAAWNSTLPGRWDRQRRLQFVETPAVSDIA
PVRSVLEGPTRNDWLSEKTGTEVPPLTCLPTRHRTGQRVDMHQPGGNGHLFVIGPIGAGKSVFLNFLVSQ
ADRHKARRIRFDKDRSTRIPTLLSGGAFIDVTGKFQASTPVNPLSLLADPGSFTYVTEWLTLALEDDDFS
LSPQQSQDMFEAVKLLASYPRERWTLSALSTMLHADLRERLQIWLVGGQYGHFFDHVEDAFAVSDNLCIE
CGELFQKFPRAAALFTDYAFYRISQSMDGIRYTVIEVEECGFFFQNERFYKRFEDWITTIRKLNGAIWAA
TQSLRQIARVANFEILKENIANWIYLPNSQAKTSTDLYGDMFGLTKDQIQMISDAVPNRDYLWITNVQTR
MLQTAFNDEMVAMLRSDGVAQSICDTHYASGEPDWQDRYVREMLARAA
 
Nucleotide Sequence: 2457 bp     [Download]
>gi|56550557|ref|NC_006525.1|:c17560-15104 Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence
ATGCTGAAGCTGAAACGACGGCCGCTGGCGGAAATCGCGCCGTGGCTCACCTCGATTACTCCCGAGCTCA
TCCTGAACAAGGACGGATCACTGCTCGCTAACTACGAATTCCGTGGTGTGGATGCCGATAGCGCGGACGC
GAGCGACATCACCTCCGCGCGAGACCAGCTCGACCAAGCGTGCCGCTCCTTTGACAACCGCATCACAGCT
TGGTGGCGCCTGACGCACCGACGTACCAAGGGATACGTCGACGGCGAGTTCAGCAACGGAACGGATGCAC
GTCTCGACGCGCTCAACCGCGCCCACATGACCACGGGCAGGTATTACCGCAATGCGCATTCGCTGAGCAT
CGCCTATACCCCCGAGACGGGCGTGGCCAAGTTCTTCGAGAAGATTGGGCATCACATGACCGTGGGCGGT
AAGCCGATTTTCGCCGCCCTGCTCGAAGCGACCAAGGATACGGTCCTTGCCCGCAGCGCGTTCGCCTTCG
ACATGGAGAAAATCCGCTCCGACACGCGGCGCTTCGAAGCCATGCTGGACGCATTTACCGGTGGGATTCC
GCGCATCAAGCCAACGCGCCTTGCGATGCAGGACAGCTACGCCGCGCTCCACCAGGTCGCCAACCCCAGT
GTGCCGAAGCGTCGCATCCGTTTCCCGGTAACGATGCTCGACACCCATCTGAGTGAGTCGGAAATTACGG
TTGGCTCCGAGCGCCTTCTGTTCGAATCCGCACATGGCAAACGCTATGCCGCTATCGTTGCCGTCAAGGA
ATGGATGAGCTTCCAGGAAGCGGCGCTCGACACTCTGCTGCAAGTCGACGCCGAGCTGGATATCTGCATC
ATGTACCGCTTTCTGGACACCGCCCGGGCAACGGCCTATATCGAGAAGGTGCGCCGCTTCTACAAGATGG
CGGCGGTCAACCTCCGTTCGATGGTCCAGCAATATATGTCGAAGGAGGAGAACGAGAATGACGAGGGGCG
GGAGGAACTCGCCAAGGAAGCGGGCAAGGCACTAAAGCGACTGACCGCTGAAGGCGTACAGCACGGATTC
GCCAACATCTCCATAGTCGTCTACGCCGACACCGAGGCGGAATGCGAGGATGCCGTCAGCGAGGTGGTAG
GAACACTGACGAACGCTGGCTTTGGCGCGATTCGGGAGAAGACCAATCTGATGGCGGCGTGGAACAGCAC
GCTGCCCGGCCGCTGGGACCGCCAGCGACGCTTGCAGTTTGTCGAGACACCCGCGGTTTCCGACATTGCT
CCTGTACGGTCGGTGCTCGAGGGTCCGACGCGCAACGACTGGCTGTCGGAGAAGACAGGCACGGAAGTGC
CGCCACTCACCTGCCTGCCCACCCGTCATCGGACTGGCCAGCGCGTCGATATGCATCAACCAGGCGGCAA
TGGACACCTGTTTGTAATCGGGCCCATCGGCGCGGGGAAGTCAGTTTTCCTCAACTTCCTAGTGTCGCAG
GCGGATCGGCACAAGGCGCGTCGCATCCGTTTCGACAAAGACCGCTCCACGCGTATCCCCACGCTGCTGA
GCGGGGGGGCATTCATCGACGTAACCGGCAAGTTCCAGGCGAGCACACCGGTCAATCCGCTGTCTCTGCT
CGCCGACCCGGGCAGCTTTACCTACGTCACCGAATGGCTAACGCTGGCCCTCGAAGACGACGATTTCTCC
CTTTCTCCGCAACAGAGTCAGGACATGTTCGAGGCAGTGAAGCTGCTCGCGAGCTATCCCCGCGAGCGGT
GGACCCTCAGTGCCCTCTCCACGATGCTCCATGCCGATCTGCGCGAGCGGCTTCAGATCTGGCTGGTGGG
CGGGCAGTACGGCCACTTCTTTGATCACGTCGAGGATGCGTTCGCAGTGAGCGACAACCTCTGCATCGAG
TGCGGCGAACTGTTCCAGAAGTTTCCTCGGGCGGCAGCTCTCTTCACCGACTATGCGTTCTACCGGATTA
GCCAGTCGATGGACGGCATCCGCTACACCGTCATCGAAGTGGAGGAATGCGGCTTCTTCTTTCAGAACGA
GCGCTTCTATAAGCGTTTCGAAGACTGGATCACCACCATCCGGAAGCTCAACGGAGCCATCTGGGCGGCG
ACGCAGTCCCTGCGGCAAATCGCGCGTGTGGCGAATTTTGAAATCCTCAAGGAAAACATCGCCAACTGGA
TCTATCTGCCGAACAGCCAGGCAAAGACGAGCACGGACCTTTACGGAGACATGTTTGGCCTGACCAAAGA
CCAGATCCAGATGATCTCCGATGCGGTACCGAACCGTGACTACCTCTGGATCACCAACGTCCAGACCCGC
ATGCTCCAGACCGCTTTCAACGACGAGATGGTGGCGATGCTGCGCTCGGACGGTGTGGCGCAATCCATCT
GCGACACCCATTACGCGTCGGGCGAGCCCGACTGGCAAGACCGCTACGTGCGCGAAATGCTCGCGCGCGC
AGCCTAA
 Primer design