SecReT4
Protein ID: 56550571
T4SS name [ID]Trb [612]
Gene symbol-
Locus tagRMe0013
StrainCupriavidus metallidurans CH34 plasmid pMOL28 (NC_006525)
Repliconplasmid pMOL28 [GenBank: NC_006525] [Browse all T4SS(s) in this replicon]
Location [Strand]17885..18232 [-]
Producthypothetical protein
Component typeTrbC
UniProt IDQ5NV44
KEGG IDrme:Rmet_6303
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.6e-07, Aligned region: 11..105
Protein Sequence: 115 a.a.     [Download]
>gi|56550571|ref|YP_161637.1| hypothetical protein RMe0013 [Cupriavidus metallidurans CH34]
MTLTFNHRVRATARKYAPSALLMVGMMAVATSAVAADDAFLNNLGNFICGIATFINTKYLFVVGLIVIVL
GAYAYANAESSLSKFISGACVGVGLAAAAPSILKSLGLIASCVGF
 
Nucleotide Sequence: 348 bp     [Download]
>gi|56550557|ref|NC_006525.1|:c18232-17885 Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence
ATGACCCTAACCTTCAACCACCGCGTGCGCGCCACCGCACGCAAGTACGCGCCCTCGGCCCTGCTGATGG
TCGGCATGATGGCTGTCGCCACGTCGGCGGTTGCCGCTGACGACGCATTCCTGAATAACCTCGGCAACTT
CATCTGTGGCATCGCGACGTTCATCAACACGAAGTATCTCTTCGTGGTGGGCCTGATCGTGATCGTCCTG
GGCGCCTACGCGTACGCGAACGCGGAGTCGTCCCTCTCCAAATTTATCTCCGGCGCCTGCGTCGGCGTGG
GTCTAGCGGCCGCTGCCCCTTCCATCCTGAAGTCGCTAGGCCTGATCGCCTCCTGTGTCGGTTTCTGA
 Primer design