SecReT4
Protein ID: 56550572
T4SS name [ID]Trb [612]
Gene symboltraJ
Locus tagRMe0014
StrainCupriavidus metallidurans CH34 plasmid pMOL28 (NC_006525)
Repliconplasmid pMOL28 [GenBank: NC_006525] [Browse all T4SS(s) in this replicon]
Location [Strand]18252..19301 [-]
Producthypothetical protein
Component typeTrbB
UniProt IDQ5NV43
KEGG IDrme:Rmet_6302
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.9e-63, Aligned region: 29..323
Protein Sequence: 349 a.a.     [Download]
>gi|56550572|ref|YP_161638.1| hypothetical protein RMe0014 [Cupriavidus metallidurans CH34]
MESPANNHPLLQLTQLADSAVSMFFESLAPLHDVIHASDVAEVMINRHDSIWVERRGVLTKLDIVLDPIK
VEGAVRSLASSVEKSAVRGTSQGIINAGHKGLRIAAVMQPTAIDGHALSIRRHRETNLTLEDYAKAGAFS
LRNATTKAEEPIFLGNEEDEALMRALEQLIVRRKNVIVAGGTSSGKTTFLNALAGRVPATDRVLTIEDTM
ELKLTVPNLVRLLSNKDKGVTTQHLVALALRFRPDRIFVGEVRFGEAFDMLQAFNTGHDGGMASLHASSA
RSALSRLESMALLGIPPGSGWKLDDMRKLIADCIHYVVHMKRTGEMRHVSEIIEIKGFSNGDYDINRVF
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|56550557|ref|NC_006525.1|:c19301-18252 Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence
ATGGAATCCCCAGCGAACAACCACCCTCTTTTGCAGCTCACGCAGCTCGCCGACAGCGCAGTCTCGATGT
TCTTCGAGTCGCTGGCGCCACTGCACGATGTCATCCATGCGTCGGACGTCGCGGAAGTCATGATCAACCG
CCACGACAGTATCTGGGTGGAGCGACGTGGGGTACTGACCAAGCTCGATATCGTCTTGGACCCAATTAAG
GTGGAAGGCGCCGTTCGCTCCCTCGCCTCTTCCGTTGAAAAGTCCGCTGTGCGCGGAACCTCCCAGGGCA
TCATCAATGCCGGCCACAAAGGTCTGCGGATCGCGGCGGTCATGCAGCCGACCGCGATCGACGGCCACGC
ACTGAGCATTCGTCGCCACCGCGAAACGAACCTGACGCTGGAGGACTACGCCAAGGCGGGCGCGTTTTCA
TTGCGCAACGCGACCACGAAGGCTGAGGAGCCGATCTTCCTGGGCAACGAGGAAGACGAGGCGTTGATGC
GTGCGCTCGAGCAGTTGATCGTAAGGCGCAAGAACGTCATCGTTGCGGGCGGCACGTCGTCGGGCAAGAC
CACTTTCCTTAACGCGCTCGCCGGCCGCGTCCCGGCCACCGACCGAGTCCTCACCATCGAGGACACGATG
GAACTCAAGCTGACGGTACCGAATCTGGTGCGTCTGCTCTCGAACAAGGACAAGGGCGTCACTACGCAAC
ACCTCGTCGCGCTCGCCTTGCGTTTCCGACCCGATCGCATCTTCGTTGGCGAAGTTCGCTTTGGCGAGGC
GTTCGACATGTTGCAGGCGTTCAACACCGGCCACGACGGCGGCATGGCGTCCCTTCACGCCAGCAGCGCT
CGCTCGGCCCTATCTCGCCTGGAGAGCATGGCGCTTCTTGGGATTCCCCCCGGCTCGGGATGGAAGCTCG
ACGACATGAGAAAGCTCATTGCCGATTGCATTCACTACGTGGTGCACATGAAGCGCACCGGTGAAATGCG
TCACGTCTCGGAAATCATTGAGATCAAGGGTTTCAGCAACGGCGATTACGACATCAACCGCGTTTTTTAA
 Primer design