SecReT4
Protein ID: 56550574
T4SS name [ID]Trb [612]
Gene symboltrbG
Locus tagRMe0016
StrainCupriavidus metallidurans CH34 plasmid pMOL28 (NC_006525)
Repliconplasmid pMOL28 [GenBank: NC_006525] [Browse all T4SS(s) in this replicon]
Location [Strand]20425..21336 [+]
Producthypothetical protein
Component typeTrbG
UniProt IDQ5NV41
KEGG IDrme:Rmet_6300
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.3e-52, Aligned region: 71..294
Protein Sequence: 303 a.a.     [Download]
>gi|56550574|ref|YP_161640.1| hypothetical protein RMe0016 [Cupriavidus metallidurans CH34]
MEARTPSRFIPLAIALCMAMLLSAPDSHAADKNARRTGAGMAGLGIGDLSDAMNPANPFNGGVDPIALPG
DSRLVVFTYSRDQIFRVLSAPLKITTIEFPDDEQIVGDPAWGENVRWDYDTDGANHLYVKPQAAGLVNTL
SVNTNKRSYEFTLVSSPLGGIFYQKVRFKVPTSISAKVKARNDARGEAPDEAKGAEAEGSRNPDAVGVSP
DQLNFEYAISGSASFKPETAFDDGKALWLRLPNAALQNWPVAFIKDGSDFVVVNAIRRGGYLVVQRLADT
VVLRSGDDEVKIERGRRRILGLF
 
Nucleotide Sequence: 912 bp     [Download]
>gi|56550557|ref|NC_006525.1|:20425-21336 Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence
ATGGAAGCTCGCACCCCCTCCCGGTTCATCCCTCTGGCCATTGCGCTGTGCATGGCCATGCTGCTTTCCG
CTCCGGACAGTCATGCGGCCGACAAAAATGCGCGTCGCACCGGCGCCGGCATGGCCGGACTGGGAATCGG
CGACCTCAGCGACGCTATGAATCCGGCCAATCCGTTCAATGGCGGCGTTGATCCGATCGCATTGCCGGGT
GACTCTCGGCTTGTGGTCTTCACCTACAGCCGAGATCAGATCTTCCGCGTGCTCAGCGCACCGCTGAAGA
TCACAACCATCGAATTTCCAGACGACGAACAGATCGTTGGCGATCCCGCCTGGGGCGAAAACGTGCGATG
GGACTACGACACGGACGGTGCCAATCATCTTTACGTGAAGCCGCAGGCGGCGGGGCTGGTCAACACGCTG
TCGGTCAATACGAACAAGCGGAGCTATGAGTTCACGCTCGTATCGTCTCCGCTCGGCGGCATTTTTTACC
AAAAGGTCCGGTTCAAGGTTCCGACGTCGATCTCCGCCAAGGTGAAGGCGCGCAACGACGCGCGTGGTGA
AGCGCCGGACGAAGCCAAGGGTGCAGAAGCCGAAGGATCGCGCAATCCGGATGCGGTTGGCGTTTCTCCC
GATCAACTGAATTTCGAGTATGCGATTTCGGGGAGCGCCAGTTTCAAGCCGGAAACTGCCTTTGACGATG
GCAAGGCGCTCTGGTTGCGCCTGCCCAACGCAGCGCTGCAGAACTGGCCGGTCGCTTTCATCAAGGACGG
CAGCGATTTCGTGGTGGTCAATGCCATCCGCCGTGGCGGGTACCTCGTGGTGCAGCGACTGGCTGATACC
GTCGTGCTGCGCTCGGGCGACGATGAAGTGAAGATCGAGCGCGGCCGCCGCCGCATCCTGGGGCTGTTCT
GA
 Primer design