SecReT4
Protein ID: 56550575
T4SS name [ID]Trb [612]
Gene symboltrbI
Locus tagRMe0017
StrainCupriavidus metallidurans CH34 plasmid pMOL28 (NC_006525)
Repliconplasmid pMOL28 [GenBank: NC_006525] [Browse all T4SS(s) in this replicon]
Location [Strand]21336..22580 [+]
Producthypothetical protein
Component typeTrbI
UniProt IDQ5NV40
KEGG IDrme:Rmet_6299
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.3e-49, Aligned region: 229..409
Protein Sequence: 414 a.a.     [Download]
>gi|56550575|ref|YP_161641.1| hypothetical protein RMe0017 [Cupriavidus metallidurans CH34]
MRGKQNADNVTDVTDAQERTVKGKLPRNVVLALGGAAALMVGALGYYFQTVSDEQIDAKAQQARADEIKQ
RAGSADTGQSLDAVIRAQADKAREESEKQRKLAIATDTKAPVMTAGDLTSAAKATGAAPDAKKNAEDDLF
TSSVFKSGTRKSQVAQVKQPSGMPDVTDPAQMRAIQQAVAAKAAAANAAGATPEGVAPQASSSDRQFLRD
AGSLNTLRTGFDGKLPRCTLSRGFVIPANFAGGLNSDKPGEFRATVSQDVYDTVKGTCKIIPAGTTLVGM
YSADIAVGQERILTAFVRMQLPNGKTVPLMGMQGADPDGTAGNTGDVNNHFLKIFGGALVIGALSLRFND
NPTTTTVGPSGLVAYGNAAGQVATQTAQTILNRNQNIRPTITTEPGQKMMVQVKHDIVLEPYRD
 
Nucleotide Sequence: 1245 bp     [Download]
>gi|56550557|ref|NC_006525.1|:21336-22580 Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence
ATGCGTGGCAAACAAAATGCGGACAACGTCACCGACGTGACGGACGCGCAGGAACGGACCGTCAAGGGGA
AGCTCCCGCGCAATGTCGTCCTCGCACTGGGTGGTGCGGCGGCACTGATGGTTGGCGCCCTGGGCTATTA
CTTCCAGACCGTCTCGGACGAGCAGATCGACGCCAAGGCTCAGCAAGCGCGAGCCGATGAAATCAAGCAA
CGTGCCGGCAGCGCGGATACCGGGCAGAGCCTGGATGCGGTCATTCGTGCGCAGGCGGACAAGGCGCGTG
AGGAATCCGAGAAACAGCGCAAACTGGCCATTGCGACGGATACCAAGGCGCCCGTCATGACCGCCGGCGA
TCTCACTAGCGCGGCGAAAGCCACAGGCGCTGCGCCGGATGCGAAGAAGAATGCGGAAGATGACCTCTTC
ACGTCCTCAGTATTCAAGAGCGGGACACGCAAGTCCCAGGTCGCACAGGTAAAGCAGCCGTCAGGCATGC
CGGACGTGACGGATCCCGCGCAGATGCGTGCAATCCAGCAGGCTGTCGCGGCAAAGGCGGCCGCCGCGAA
TGCTGCGGGGGCGACCCCGGAGGGCGTTGCGCCGCAGGCATCCTCGTCGGATCGCCAGTTCCTGCGCGAC
GCGGGAAGTCTGAACACGCTGCGAACCGGGTTCGACGGCAAGCTGCCGCGCTGCACGCTGAGCCGCGGCT
TCGTGATTCCCGCCAACTTCGCCGGCGGCCTCAACTCGGACAAGCCGGGTGAGTTTCGTGCAACGGTATC
GCAGGACGTCTACGACACCGTCAAGGGTACGTGCAAAATTATTCCGGCCGGCACCACGTTGGTTGGGATG
TATAGCGCAGACATTGCTGTGGGCCAGGAACGCATCCTGACCGCTTTCGTGCGCATGCAACTGCCAAATG
GGAAAACCGTTCCCCTGATGGGCATGCAGGGTGCGGACCCGGACGGCACGGCTGGCAATACAGGCGACGT
CAACAACCACTTCCTCAAGATCTTCGGCGGTGCGCTCGTGATCGGCGCCCTGTCGCTGCGTTTCAACGAC
AACCCGACAACTACCACGGTAGGACCCTCGGGTCTGGTGGCGTACGGCAATGCGGCCGGACAGGTAGCGA
CCCAGACGGCGCAGACGATTCTGAACCGCAACCAGAACATCCGCCCGACCATCACCACCGAGCCGGGGCA
GAAGATGATGGTGCAGGTCAAGCACGATATCGTCCTGGAGCCGTATCGTGACTAA
 Primer design